Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameElongation of fatty acids protein 1
SynonymsNot Available
Gene NameELO1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in fatty acid elongase activity
Specific FunctionMay be a membrane bound enzyme involved in the highly specific elongation of saturated 14-carbon fatty acids (14:0) to 16-carbon species (16:0)
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
SMPDB Reactions
Palmityl-CoA + malonyl-CoA + hydronCarbon dioxide + 3-oxooctadecanoyl-CoA + Coenzyme A
Eicosanoyl-CoA + malonyl-CoA + hydronCoenzyme A + Carbon dioxide + 3-oxodocosanoyl-CoA
Docosanoyl-CoA + malonyl-CoA + hydronCoenzyme A + Carbon dioxide + 3-oxotetracosanoyl-CoA
stearoyl-CoA + hydron + malonyl-CoA3-oxoicosanoyl-CoA + Coenzyme A + Carbon dioxide
Tetracosanoyl-CoA + malonyl-CoA + hydronCoenzyme A + Carbon dioxide + 3-oxohexacosanoyl-CoA
KEGG Reactions
lauric acid + hydron + malonyl-CoA + oxygen + NADPHNADP + Carbon dioxide + Myristoleic acid + Coenzyme A + water
hydron + myristic acid + malonyl-CoA + oxygen + NADPHNADP + Carbon dioxide + Coenzyme A + palmitoleic acid + water
hydron + malonyl-CoA + oxygen + NADPH + Palmitic acidNADP + Carbon dioxide + Coenzyme A + Oleic acid + water
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB001134-Phospho-L-aspartic acidShow
YMDB00301Palmityl-CoAShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB004773-oxooctadecanoyl-CoAShow
YMDB00533malonyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00678lauric acidShow
YMDB00679myristic acidShow
YMDB00680Myristoleic acidShow
YMDB00681palmitoleic acidShow
YMDB007323-oxoicosanoyl-CoAShow
YMDB007333-oxodocosanoyl-CoAShow
YMDB007353-oxotetracosanoyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB00909Tetracosanoyl-CoA Show
YMDB00912Carbon dioxideShow
YMDB009603-oxohexacosanoyl-CoAShow
YMDB16181Eicosanoyl-CoAShow
YMDB16242Docosanoyl-CoAShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
Not Available
Process
Not Available
Gene Properties
Chromosome Locationchromosome 10
LocusYJL196C
Gene Sequence>933 bp ATGGTAAGTGATTGGAAAAATTTTTGCCTCGAGAAAGCCTCTAGGTTTCGCCCAACAATA GATAGGCCTTTTTTTAATATTTATTTGTGGGACTATTTCAATCGTGCGGTTGGGTGGGCC ACTGCAGGTCGCTTCCAGCCAAAGGATTTTGAGTTTACCGTTGGGAAGCAGCCTTTGAGT GAACCTCGTCCGGTACTGCTTTTTATTGCCATGTATTATGTGGTTATATTTGGCGGGAGG TCCCTGGTAAAGTCATGTAAACCTCTCAAGTTGAGATTTATTTCTCAAGTCCATAACTTG ATGTTGACTTCTGTTTCCTTTTTATGGTTGATTTTGATGGTGGAACAGATGCTACCCATA GTGTATCGCCATGGGCTGTATTTTGCTGTTTGTAATGTTGAATCGTGGACGCAACCGATG GAGACATTATATTATCTCAACTATATGACAAAGTTTGTGGAGTTCGCAGACACTGTCTTG ATGGTGTTGAAACATAGAAAGTTGACTTTCCTACATACATACCATCATGGTGCTACAGCT TTACTGTGCTATAATCAATTGGTTGGTTACACAGCAGTTACATGGGTTCCTGTCACCTTA AACTTAGCTGTTCACGTTCTTATGTATTGGTATTATTTCCTTTCTGCTAGCGGAATTCGT GTTTGGTGGAAAGCCTGGGTTACAAGACTACAAATTGTGCAGTTCATGCTTGATCTCATT GTCGTTTATTACGTGCTTTATCAGAAGATTGTTGCTGCATATTTCAAAAATGCTTGTACT CCACAGTGTGAGGATTGCTTAGGTTCAATGACGGCTATTGCTGCTGGTGCAGCCATTCTT ACATCCTACTTGTTTTTGTTCATCTCTTTCTATATTGAGGTTTACAAACGTGGAAGTGCT AGTGGTAAGAAGAAGATCAACAAAAACAATTAA
Protein Properties
Pfam Domain Function
Protein Residues310
Protein Molecular Weight36233.60156
Protein Theoretical pI9.69
Signalling Regions
  • None
Transmembrane Regions
  • 64-84
  • 101-121
  • 187-207
  • 235-255
  • 272-292
Protein Sequence>Elongation of fatty acids protein 1 MVSDWKNFCLEKASRFRPTIDRPFFNIYLWDYFNRAVGWATAGRFQPKDFEFTVGKQPLS EPRPVLLFIAMYYVVIFGGRSLVKSCKPLKLRFISQVHNLMLTSVSFLWLILMVEQMLPI VYRHGLYFAVCNVESWTQPMETLYYLNYMTKFVEFADTVLMVLKHRKLTFLHTYHHGATA LLCYNQLVGYTAVTWVPVTLNLAVHVLMYWYYFLSASGIRVWWKAWVTRLQIVQFMLDLI VVYYVLYQKIVAAYFKNACTPQCEDCLGSMTAIAAGAAILTSYLFLFISFYIEVYKRGSA SGKKKINKNN
References
External Links
ResourceLink
Saccharomyces Genome Database ELO1
Uniprot IDP39540
Uniprot NameELO1_YEAST
GenBank Gene IDX77688
Genebank Protein ID547599
General Reference
  • Toke, D. A., Martin, C. E. (1996). "Isolation and characterization of a gene affecting fatty acid elongation in Saccharomyces cerevisiae." J Biol Chem 271:18413-18422.8702485
  • Purnelle, B., Coster, F., Goffeau, A. (1994). "The sequence of a 36 kb segment on the left arm of yeast chromosome X identifies 24 open reading frames including NUC1, PRP21 (SPP91), CDC6, CRY2, the gene for S24, a homologue to the aconitase gene ACO1 and two homologues to chromosome III genes." Yeast 10:1235-1249.7754713
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258