You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGeneral amino-acid permease GAP1
SynonymsNot Available
Gene NameGAP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionPermease for various amino acids as well as for GABA. Can also transport L-cysteine and beta-alanine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00016GlycineShow
YMDB00038L-IsoleucineShow
YMDB00046L-CysteineShow
YMDB00112L-SerineShow
YMDB00126L-TryptophanShow
YMDB00152L-ValineShow
YMDB00154L-AlanineShow
YMDB00214L-ThreonineShow
YMDB00226L-AsparagineShow
YMDB00232SpermidineShow
YMDB00271L-Glutamic acidShow
YMDB00304L-PhenylalanineShow
YMDB00318L-MethionineShow
YMDB00330L-LysineShow
YMDB00364L-TyrosineShow
YMDB00369L-HistidineShow
YMDB00378L-ProlineShow
YMDB00387L-LeucineShow
YMDB00592L-ArginineShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
establishment of localization
transport
amine transport
amino acid transport
transmembrane transport
Gene Properties
Chromosome Locationchromosome 11
LocusYKR039W
Gene Sequence>1809 bp ATGAGTAATACTTCTTCGTACGAGAAGAATAATCCAGATAATCTGAAACACAATGGTATT ACCATAGATTCTGAGTTTCTAACTCAGGAGCCAATAACCATTCCCTCAAATGGCTCCGCT GTTTCTATTGACGAAACAGGTTCAGGGTCCAAATGGCAAGACTTTAAAGATTCTTTCAAA AGGGTAAAACCTATTGAAGTTGATCCTAATCTTTCAGAAGCTGAAAAAGTGGCTATCATC ACTGCCCAAACTCCATTGAAGCACCACTTGAAGAATAGACATTTGCAAATGATTGCCATC GGTGGTGCCATCGGTACTGGTCTGCTGGTTGGGTCAGGTACTGCACTAAGAACAGGTGGT CCCGCTTCGCTACTGATTGGATGGGGGTCTACAGGTACCATGATTTACGCTATGGTTATG GCTCTGGGTGAGTTGGCTGTTATCTTCCCTATTTCGGGTGGGTTCACCACGTACGCTACC AGATTTATTGATGAGTCCTTTGGTTACGCTAATAATTTCAATTATATGTTACAATGGTTG GTTGTGCTACCATTGGAAATTGTCTCTGCATCTATTACTGTAAATTTCTGGGGTACAGAT CCAAAGTATAGAGATGGGTTTGTTGCGTTGTTTTGGCTTGCAATTGTTATCATCAATATG TTTGGTGTCAAAGGTTATGGTGAAGCAGAATTCGTCTTTTCATTTATCAAGGTCATCACT GTTGTTGGGTTCATCATCTTAGGTATCATTCTAAACTGTGGTGGTGGTCCAACAGGTGGT TACATTGGGGGCAAGTACTGGCATGATCCTGGTGCCTTTGCTGGTGACACTCCAGGTGCT AAATTCAAAGGTGTTTGTTCTGTCTTCGTCACCGCTGCCTTTTCTTTTGCCGGTTCAGAA TTGGTTGGTCTTGCTGCCAGTGAATCCGTAGAGCCTAGAAAGTCCGTTCCTAAGGCTGCT AAACAAGTTTTCTGGAGAATCACCCTATTTTATATTCTGTCGCTATTAATGATTGGTCTT TTAGTCCCATACAACGATAAAAGTTTGATTGGTGCCTCCTCTGTGGATGCTGCTGCTTCA CCCTTCGTCATTGCCATTAAGACTCACGGTATCAAGGGTTTGCCAAGTGTTGTCAACGTC GTTATCTTGATTGCCGTGTTATCTGTCGGTAACTCTGCCATTTATGCATGTTCCAGAACA ATGGTTGCCCTAGCTGAACAGAGATTTCTGCCAGAAATCTTTTCCTACGTTGACCGTAAG GGTAGACCATTGGTGGGAATTGCTGTCACATCTGCATTCGGTCTTATTGCGTTTGTTGCC GCCTCCAAAAAGGAAGGTGAAGTTTTCAACTGGTTACTAGCCTTGTCTGGGTTGTCATCT CTATTCACATGGGGTGGTATCTGTATTTGTCACATTCGTTTCAGAAAGGCATTGGCCGCC CAAGGAAGAGGCTTGGATGAATTGTCTTTCAAGTCTCCTACCGGTGTTTGGGGTTCCTAC TGGGGGTTATTTATGGTTATTATTATGTTCATTGCCCAATTCTACGTTGCCGTATTCCCC GTGGGAGATTCTCCAAGTGCGGAAGGTTTCTTCGAAGCTTATCTATCCTTCCCACTTGTT ATGGTTATGTACATCGGACACAAGATCTATAAGAGGAATTGGAAGCTTTTCATCCCAGCA GAAAAGATGGACATTGATACGGGTAGAAGAGAAGTCGATTTAGATTTGTTGAAACAAGAA ATTGCAGAAGAAAAGGCAATTATGGCCACAAAGCCAAGATGGTATAGAATCTGGAATTTC TGGTGTTAA
Protein Properties
Pfam Domain Function
Protein Residues602
Protein Molecular Weight65654.89844
Protein Theoretical pI8.67
Signalling Regions
  • None
Transmembrane Regions
  • 96-116
  • 122-142
  • 166-185
  • 205-224
  • 238-256
  • 281-298
  • 322-342
  • 377-396
  • 422-442
  • 452-472
  • 492-510
  • 530-548
Protein Sequence>General amino-acid permease GAP1 MSNTSSYEKNNPDNLKHNGITIDSEFLTQEPITIPSNGSAVSIDETGSGSKWQDFKDSFK RVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGG PASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWL VVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVIT VVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSE LVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAAS PFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRK GRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAA QGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLV MVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNF WC
References
External Links
ResourceLink
Saccharomyces Genome Database GAP1
Uniprot IDP19145
Uniprot NameGAP1_YEAST
GenBank Gene IDAY723840
Genebank Protein ID51830440
General Reference
  • Jauniaux, J. C., Grenson, M. (1990). "GAP1, the general amino acid permease gene of Saccharomyces cerevisiae. Nucleotide sequence, protein similarity with the other bakers yeast amino acid permeases, and nitrogen catabolite repression." Eur J Biochem 190:39-44.2194797
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • During-Olsen, L., Regenberg, B., Gjermansen, C., Kielland-Brandt, M. C., Hansen, J. (1999). "Cysteine uptake by Saccharomyces cerevisiae is accomplished by multiple permeases." Curr Genet 35:609-617.10467005
  • Stolz, J., Sauer, N. (1999). "The fenpropimorph resistance gene FEN2 from Saccharomyces cerevisiae encodes a plasma membrane H+-pantothenate symporter." J Biol Chem 274:18747-18752.10373490
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740.14557538
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258