You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeroxisomal hydratase-dehydrogenase-epimerase
Synonyms
  • HDE
  • Multifunctional beta-oxidation protein
  • MFP
  • 2-enoyl-CoA hydratase
  • (3R)-3-hydroxyacyl-CoA dehydrogenase
Gene NameFOX2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionSecond trifunctional enzyme acting on the beta-oxidation pathway for fatty acids, possessing hydratase-dehydrogenase- epimerase activities. Converts trans-2-enoyl-CoA via D-3- hydroxyacyl-CoA to 3-ketoacyl-CoA
Cellular LocationPeroxisome
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
SMPDB Reactions
(3R)-3-hydroxy-stearoyl-CoAtrans-octadec-2-enoyl-CoA + water
(3R)-3-hydroxy-arachidoyl-CoAwater + (2E)-eicosenoyl-CoA
(3R)-3-hydroxy-docosanoyl-CoA water + trans-docos-2-enoyl-CoA
(3R)-hydroxytetracosanoyl-CoAwater + (2E)-lignocerenoyl-CoA
(3R)-hydroxyhexacosanoyl-CoAwater + (2E)-cerotenoyl-CoA
KEGG Reactions
(S)-3-hydroxydecanoyl-CoAwater + trans-dec-2-enoyl-CoA
(S)-3-hydroxylauroyl-CoA(2E)-Dodecenoyl-CoA + water
water + trans-hexacos-2-enoyl-CoA(S)-3-hydroxyhexacosanoyl-CoA
(S)-3-hydroxypalmitoyl-CoAwater + hexadec-2-enoyl-CoA
3-hydroxyoctadecanoyl-CoAtrans-octadec-2-enoyl-CoA + water
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00412NAD(+)Show
YMDB00463trans-dec-2-enoyl-CoAShow
YMDB00464(S)-3-hydroxydecanoyl-CoAShow
YMDB00465(S)-3-hydroxylauroyl-CoAShow
YMDB00466trans-dodec-2-enoyl-CoAShow
YMDB00467trans-hexacos-2-enoyl-CoAShow
YMDB00468(S)-3-hydroxypalmitoyl-CoAShow
YMDB00469hexadec-2-enoyl-CoAShow
YMDB00470trans-octadec-2-enoyl-CoAShow
YMDB004713-hydroxyoctadecanoyl-CoAShow
YMDB00472trans-tetradec-2-enoyl-CoAShow
YMDB00473(S)-3-hydroxytetradecanoyl-CoAShow
YMDB004743-oxodecanoyl-CoAShow
YMDB004753-oxolauroyl-CoAShow
YMDB004763-oxopalmitoyl-CoAShow
YMDB004773-oxooctadecanoyl-CoAShow
YMDB004783-oxotetradecanoyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00959(S)-3-hydroxyhexacosanoyl-CoAShow
YMDB009603-oxohexacosanoyl-CoAShow
YMDB16167(S)-Hydroxyoctanoyl-CoAShow
YMDB161683-Oxooctanoyl-CoAShow
YMDB16169(S)-Hydroxyhexanoyl-CoAShow
YMDB161703-Oxohexanoyl-CoAShow
YMDB16292(3R)-3-hydroxy-stearoyl-CoAShow
YMDB16293(3R)-3-hydroxy-arachidoyl-CoAShow
YMDB16294(2E)-eicosenoyl-CoAShow
YMDB16295(3R)-3-hydroxy-docosanoyl-CoA Show
YMDB16296trans-docos-2-enoyl-CoAShow
YMDB16297(3R)-hydroxytetracosanoyl-CoAShow
YMDB16298(2E)-lignocerenoyl-CoAShow
YMDB16299(3R)-hydroxyhexacosanoyl-CoAShow
YMDB16300(2E)-cerotenoyl-CoAShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
binding
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKR009C
Gene Sequence>2703 bp ATGCCTGGAAATTTATCCTTCAAAGATAGAGTTGTTGTAATCACGGGCGCTGGAGGGGGC TTAGGTAAGGTGTATGCACTAGCTTACGCAAGCAGAGGTGCAAAAGTGGTCGTCAATGAT CTAGGTGGCACTTTGGGTGGTTCAGGACATAACTCCAAAGCTGCAGACTTAGTGGTGGAT GAGATAAAAAAAGCCGGAGGTATAGCTGTGGCAAATTACGACTCTGTTAATGAAAATGGA GAGAAAATAATTGAAACGGCTATAAAAGAATTCGGCAGGGTTGATGTACTAATTAACAAC GCTGGAATATTAAGGGATGTTTCATTTGCAAAGATGACAGAACGTGAGTTTGCATCTGTG GTAGATGTTCATTTGACAGGTGGCTATAAGCTATCGCGTGCTGCTTGGCCTTATATGCGC TCTCAGAAATTTGGTAGAATCATTAACACCGCTTCCCCTGCCGGTCTATTTGGAAATTTT GGTCAAGCTAATTATTCAGCAGCTAAAATGGGCTTAGTTGGTTTGGCGGAAACCCTCGCG AAGGAGGGTGCCAAATACAACATTAATGTTAATTCAATTGCGCCATTGGCTAGATCACGT ATGACAGAAAACGTGTTACCACCACATATCTTGAAACAGTTAGGACCGGAAAAAATTGTT CCCTTAGTACTCTATTTGACACACGAAAGTACGAAAGTGTCAAACTCCATTTTTGAACTC GCTGCTGGATTCTTTGGACAGCTCAGATGGGAGAGGTCTTCTGGACAAATTTTCAATCCA GACCCCAAGACATATACTCCTGAAGCAATTTTAAATAAGTGGAAGGAAATCACAGACTAT AGGGACAAGCCATTTAACAAAACTCAGCATCCATATCAACTCTCGGATTATAATGATTTA ATCACCAAAGCAAAAAAATTACCTCCCAATGAACAAGGCTCAGTGAAAATCAAGTCGCTT TGCAACAAAGTCGTAGTAGTTACGGGTGCAGGAGGTGGTCTTGGGAAGTCTCATGCAATC TGGTTTGCACGGTACGGTGCGAAGGTAGTTGTAAATGACATCAAGGATCCTTTTTCAGTT GTTGAAGAAATAAATAAACTATATGGTGAAGGCACAGCCATTCCAGATTCCCATGATGTG GTCACCGAAGCTCCTCTCATTATCCAAACTGCAATAAGTAAGTTTCAGAGAGTAGACATC TTGGTCAATAACGCTGGTATTTTGCGTGACAAATCTTTTTTAAAAATGAAAGATGAGGAA TGGTTTGCTGTCCTGAAAGTCCACCTTTTTTCCACATTTTCATTGTCAAAAGCAGTATGG CCAATATTTACCAAACAAAAGTCTGGATTTATTATCAATACTACTTCTACCTCAGGAATT TATGGTAATTTTGGACAGGCCAATTATGCCGCTGCAAAAGCCGCCATTTTAGGATTCAGT AAAACTATTGCACTGGAAGGTGCCAAGAGAGGAATTATTGTTAATGTTATCGCTCCTCAT GCAGAAACGGCTATGACAAAGACTATATTCTCGGAGAAGGAATTATCAAACCACTTTGAT GCATCTCAAGTCTCCCCACTTGTTGTTTTGTTGGCATCTGAAGAACTACAAAAGTATTCT GGAAGAAGGGTTATTGGCCAATTATTCGAAGTTGGCGGTGGTTGGTGTGGGCAAACCAGA TGGCAAAGAAGTTCCGGTTATGTTTCTATTAAAGAGACTATTGAACCGGAAGAAATTAAA GAAAATTGGAACCACATCACTGATTTCAGTCGCAACACTATCAACCCGAGCTCCACAGAG GAGTCTTCTATGGCAACCTTGCAAGCCGTGCAAAAAGCGCACTCTTCAAAGGAGTTGGAT GATGGATTATTCAAGTACACTACCAAGGATTGTATCTTGTACAATTTAGGACTTGGATGC ACAAGCAAAGAGCTTAAGTACACCTACGAGAATGATCCAGACTTCCAAGTTTTGCCCACG TTCGCCGTCATTCCATTTATGCAAGCTACTGCCACACTAGCTATGGACAATTTAGTCGAT AACTTCAATTATGCAATGTTACTGCATGGAGAACAATATTTTAAGCTCTGCACGCCGACA ATGCCAAGTAATGGAACTCTAAAGACACTTGCTAAACCTTTACAAGTACTTGACAAGAAT GGTAAAGCCGCTTTAGTTGTTGGTGGCTTCGAAACTTATGACATTAAAACTAAGAAACTC ATAGCTTATAACGAAGGATCGTTCTTCATCAGGGGCGCACATGTACCTCCAGAAAAGGAA GTGAGGGATGGGAAAAGAGCCAAGTTTGCTGTCCAAAATTTTGAAGTGCCACATGGAAAG GTACCAGATTTTGAGGCGGAGATTTCTACGAATAAAGATCAAGCCGCATTGTACAGGTTA TCTGGCGATTTCAATCCTTTACATATCGATCCCACGCTAGCCAAAGCAGTTAAATTTCCT ACGCCAATTCTGCATGGGCTTTGTACATTAGGTATTAGTGCGAAAGCATTGTTTGAACAT TATGGTCCATATGAGGAGTTGAAAGTGAGATTTACCAATGTTGTTTTCCCAGGTGATACT CTAAAGGTTAAAGCTTGGAAGCAAGGCTCGGTTGTCGTTTTTCAAACAATTGATACGACC AGAAACGTCATTGTATTGGATAACGCCGCTGTAAAACTATCGCAGGCAAAATCTAAACTA TAA
Protein Properties
Pfam Domain Function
Protein Residues900
Protein Molecular Weight98702.39844
Protein Theoretical pI9.46
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Peroxisomal hydratase-dehydrogenase-epimerase MPGNLSFKDRVVVITGAGGGLGKVYALAYASRGAKVVVNDLGGTLGGSGHNSKAADLVVD EIKKAGGIAVANYDSVNENGEKIIETAIKEFGRVDVLINNAGILRDVSFAKMTEREFASV VDVHLTGGYKLSRAAWPYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLA KEGAKYNINVNSIAPLARSRMTENVLPPHILKQLGPEKIVPLVLYLTHESTKVSNSIFEL AAGFFGQLRWERSSGQIFNPDPKTYTPEAILNKWKEITDYRDKPFNKTQHPYQLSDYNDL ITKAKKLPPNEQGSVKIKSLCNKVVVVTGAGGGLGKSHAIWFARYGAKVVVNDIKDPFSV VEEINKLYGEGTAIPDSHDVVTEAPLIIQTAISKFQRVDILVNNAGILRDKSFLKMKDEE WFAVLKVHLFSTFSLSKAVWPIFTKQKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFS KTIALEGAKRGIIVNVIAPHAETAMTKTIFSEKELSNHFDASQVSPLVVLLASEELQKYS GRRVIGQLFEVGGGWCGQTRWQRSSGYVSIKETIEPEEIKENWNHITDFSRNTINPSSTE ESSMATLQAVQKAHSSKELDDGLFKYTTKDCILYNLGLGCTSKELKYTYENDPDFQVLPT FAVIPFMQATATLAMDNLVDNFNYAMLLHGEQYFKLCTPTMPSNGTLKTLAKPLQVLDKN GKAALVVGGFETYDIKTKKLIAYNEGSFFIRGAHVPPEKEVRDGKRAKFAVQNFEVPHGK VPDFEAEISTNKDQAALYRLSGDFNPLHIDPTLAKAVKFPTPILHGLCTLGISAKALFEH YGPYEELKVRFTNVVFPGDTLKVKAWKQGSVVVFQTIDTTRNVIVLDNAAVKLSQAKSKL
References
External Links
ResourceLink
Saccharomyces Genome Database FOX2
Uniprot IDQ02207
Uniprot NameFOX2_YEAST
GenBank Gene IDM86456
Genebank Protein ID171947
General Reference
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Dusterhoft, A., Philippsen, P. (1992). "DNA sequencing and analysis of a 24.7 kb segment encompassing centromere CEN11 of Saccharomyces cerevisiae reveals nine previously unknown open reading frames." Yeast 8:749-759.1441752
  • Hiltunen, J. K., Wenzel, B., Beyer, A., Erdmann, R., Fossa, A., Kunau, W. H. (1992). "Peroxisomal multifunctional beta-oxidation protein of Saccharomyces cerevisiae. Molecular analysis of the fox2 gene and gene product." J Biol Chem 267:6646-6653.1551874