You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcyl-coenzyme A oxidase
Synonyms
  • Acyl-CoA oxidase
Gene NamePOX1
Enzyme Class
Biological Properties
General FunctionInvolved in acyl-CoA dehydrogenase activity
Specific FunctionAcyl-CoA + O(2) = trans-2,3-dehydroacyl-CoA + H(2)O(2)
Cellular LocationPeroxisome
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
Fatty acid metabolismec00071 Map00071
alpha-Linolenic acid metabolismec00592 Map00592
SMPDB ReactionsNot Available
KEGG Reactions
decanoyl-CoA + oxygenHydrogen peroxide + trans-dec-2-enoyl-CoA
lauroyl-CoA + oxygen(2E)-Dodecenoyl-CoA + Hydrogen peroxide
oxygen + hexacosanoyl-CoAHydrogen peroxide + trans-hexacos-2-enoyl-CoA
Palmityl-CoA + oxygenHydrogen peroxide + hexadec-2-enoyl-CoA
stearoyl-CoA + oxygentrans-octadec-2-enoyl-CoA + Hydrogen peroxide
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00312Acetyl-CoAShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00463trans-dec-2-enoyl-CoAShow
YMDB00466trans-dodec-2-enoyl-CoAShow
YMDB00467trans-hexacos-2-enoyl-CoAShow
YMDB00469hexadec-2-enoyl-CoAShow
YMDB00470trans-octadec-2-enoyl-CoAShow
YMDB00472trans-tetradec-2-enoyl-CoAShow
YMDB00527palmitoyl-CoAShow
YMDB00528myristoyl-CoAShow
YMDB00530lauroyl-CoAShow
YMDB00531octanoyl-CoAShow
YMDB00532decanoyl-CoAShow
YMDB00537hexacosanoyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00862hydronShow
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB00909Tetracosanoyl-CoA Show
GO Classification
Component
organelle
microbody
membrane-bounded organelle
peroxisome
intracellular membrane-bounded organelle
Function
catalytic activity
binding
nucleoside binding
purine nucleoside binding
oxidoreductase activity, acting on the CH-CH group of donors, oxygen as acceptor
adenyl nucleotide binding
acyl-CoA oxidase activity
FAD or FADH2 binding
oxidoreductase activity, acting on the CH-CH group of donors
oxidoreductase activity
acyl-CoA dehydrogenase activity
Process
oxoacid metabolic process
monocarboxylic acid metabolic process
metabolic process
carboxylic acid metabolic process
fatty acid metabolic process
cellular metabolic process
oxidation reduction
fatty acid catabolic process
organic acid metabolic process
fatty acid beta-oxidation
Gene Properties
Chromosome Locationchromosome 7
LocusYGL205W
Gene Sequence>2247 bp ATGACGAGACGTACTACTATTAATCCCGATTCGGTGGTTCTGAATCCTCAAAAATTTATC CAGAAAGAAAGGGCGGATTCGAAAATCAAAGTTGACCAAGTTAACACATTTTTAGAGTCA TCCCCGGAGAGGAGAACTCTGACGCACGCCTTAATAGACCAAATAGTGAATGATCCTATA TTGAAAACTGATACGGACTATTACGATGCTAAAAAAATGCAAGAGAGAGAAATTACTGCC AAAAAAATAGCTAGGCTTGCTAGTTATATGGAGCACGATATCAAAACAGTGCGCAAACAC TTTCGCGACACTGACCTGATGAAAGAGTTGCAAGCAAATGATCCAGACAAAGCTTCGCCT TTAACAAACAAAGACCTTTTTATATTCGATAAGAGATTGTCACTTGTAGCAAATATTGAT CCTCAATTGGGTACGCGCGTGGGTGTACACTTGGGGCTATTTGGTAATTGTATCAAGGGC AATGGTACTGATGAGCAAATCCGGTATTGGTTGCAGGAGAGAGGTGCCACTTTGATGAAA GGTATATATGGCTGTTTTGCAATGACTGAGTTAGGACATGGTTCCAATGTTGCCCAGCTG CAGACTAGGGCTGTGTACGATAAGCAAAATGATACTTTTGTAATTGATACACCTGATCTA ACTGCCACCAAATGGTGGATTGGTGGGGCTGCCCATTCTGCCACGCACGCTGCCGTGTAC GCCAGATTGATCGTTGAAGGTAAAGACTACGGTGTAAAAACATTCGTTGTTCCTCTGAGA GACCCTTCGACTTTCCAACTGTTAGCTGGTGTTTCCATAGGGGATATTGGAGCGAAGATG GGTCGTGACGGTATTGATAATGGCTGGATCCAGTTCAGAAACGTAGTTATCCCTAGAGAA TTTATGCTAAGTAGATTTACCAAAGTTGTCCGTTCTCCAGATGGTTCAGTCACCGTCAAA ACTGAGCCACAATTGGATCAAATTTCTGGTTATAGTGCATTGTTAAGTGGTAGAGTTAAC ATGGTCATGGATTCATTTAGGTTTGGCTCCAAATTTGCTACTATTGCTGTACGTTACGCG GTTGGTCGTCAGCAATTCGCACCTAGAAAGGGATTGTCTGAAACACAATTAATCGACTAT CCCCTTCACCAATATCGTGTTTTACCACAATTGTGTGTTCCATATTTGGTGTCACCTGTA GCTTTTAAGTTAATGGACAACTATTATTCCACTTTGGACGAGTTATACAACGCTTCCTCA TCTGCATACAAAGCTGCTCTGGTTACCGTGAGTAAAAAGTTGAAGAATTTATTTATTGAT AGCGCCACGTTGAAAGCCACCAATACTTGGTTAATTGCTACACTGATTGATGAGTTGAGA CAGACTTGCGGAGGACATGGGTATTCACAGTATAACGGATTTGGTAAAGGCTATGACGAC TGGGTGGTTCAGTGCACATGGGAGGGTGATAATAATGTTTTATCTTTAACTTCAGCAAAA TCAATATTGAAAAAATTTATCGATTCAGCCACAAAGGGTAGATTTGACAACACACTGGAT GTGGACTCATTCTCTTACTTAAAACCTCAGTACATAGGATCTGTGGTTTCTGGAGAAATA AAGAGTGGTTTAAAGGAGTTGGGTGATTATACTGAAATTTGGTCTATCACCTTAATCAAA TTACTGGCACATATTGGTACTTTAGTTGAAAAATCAAGAAGTATTGATAGCGTTTCTAAG CTTTTAGTCTTAGTATCCAAATTTCATGCCTTGCGCTGCATGTTGAAAACCTATTACGAC AAGTTAAACTCTCGTGATTCACATATTTCCGATGAAATTACAAAGGAATCTATGTGGAAT GTTTATAAGTTATTTTCCTTGTATTTTATTGACAAGCATTCCGGAGAATTCCAACAATTC AAGATCTTCACTCCTGATCAGATCTCTAAAGTTGTGCAGCCACAACTATTGGCTCTTTTG CCAATTGTGAGGAAAGACTGTATAGGTCTGACAGACTCCTTTGAATTACCTGACGCGATG TTAAATTCTCCTATAGGTTACTTTGATGGCGATATCTATCACAATTACTTCAATGAAGTT TGCCGCAATAATCCAGTGGAGGCAGATGGGGCAGGGAAGCCTTCTTATCATGCGCTGTTG AGCAGCATGCTCGGTAGAGGTTTCGAATTTGACCAAAAGTTAGGTGGTGCAGCTAATGCG GAAATTTTATCGAAAATAAACAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues748
Protein Molecular Weight84041.39844
Protein Theoretical pI8.7
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Acyl-coenzyme A oxidase MTRRTTINPDSVVLNPQKFIQKERADSKIKVDQVNTFLESSPERRTLTHALIDQIVNDPI LKTDTDYYDAKKMQEREITAKKIARLASYMEHDIKTVRKHFRDTDLMKELQANDPDKASP LTNKDLFIFDKRLSLVANIDPQLGTRVGVHLGLFGNCIKGNGTDEQIRYWLQERGATLMK GIYGCFAMTELGHGSNVAQLQTRAVYDKQNDTFVIDTPDLTATKWWIGGAAHSATHAAVY ARLIVEGKDYGVKTFVVPLRDPSTFQLLAGVSIGDIGAKMGRDGIDNGWIQFRNVVIPRE FMLSRFTKVVRSPDGSVTVKTEPQLDQISGYSALLSGRVNMVMDSFRFGSKFATIAVRYA VGRQQFAPRKGLSETQLIDYPLHQYRVLPQLCVPYLVSPVAFKLMDNYYSTLDELYNASS SAYKAALVTVSKKLKNLFIDSASLKATNTWLIATLIDELRQTCGGHGYSQYNGFGKGYDD WVVQCTWEGDNNVLSLTSAKSILKKFIDSATKGRFDNTLDVDSFSYLKPQYIGSVVSGEI KSGLKELGDYTEIWSITLIKLLAHIGTLVEKSRSIDSVSKLLVLVSKFHALRCMLKTYYD KLNSRDSHISDEITKESMWNVYKLFSLYFIDKHSGEFQQFKIFTPDQISKVVQPQLLALL PIVRKDCIGLTDSFELPDAMLNSPIGYFDGDIYHNYFNEVCRNNPVEADGAGKPSYHALL SSMLGRGFEFDQKLGGAANAEILSKINK
References
External Links
ResourceLink
Saccharomyces Genome Database POX1
Uniprot IDP13711
Uniprot NameACOX_YEAST
GenBank Gene IDM27515
Genebank Protein ID172217
General Reference
  • Dmochowska, A., Dignard, D., Maleszka, R., Thomas, D. Y. (1990). "Structure and transcriptional control of the Saccharomyces cerevisiae POX1 gene encoding acyl-coenzyme A oxidase." Gene 88:247-252.2189786
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Feuermann, M., Simeonova, L., Souciet, J. L., Potier, S. (1997). "Analysis of 21.7 kb DNA sequence from the left arm of chromosome VII reveals 11 open reading frames: two correspond to new genes." Yeast 13:475-477.9153757
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131