You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFatty acid synthase subunit beta
Synonyms
  • 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase
  • Enoyl-[acyl-carrier-protein] reductase [NADH]
  • [Acyl-carrier-protein] acetyltransferase
  • [Acyl-carrier-protein] malonyltransferase
  • S-acyl fatty acid synthase thioesterase
Gene NameFAS1
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity
Specific FunctionFatty acid synthetase catalyzes the formation of long- chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. The beta subunit contains domains for:[acyl-carrier-protein] acetyltransferase and malonyltransferase, S-acyl fatty acid synthase thioesterase, enoyl-[acyl-carrier-protein] reductase, and 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase
Cellular LocationNot Available
SMPDB Pathways
Fatty acid biosynthesisPW002458 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fatty acid biosynthesisec00061 Map00061
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00110NADShow
YMDB001134-Phospho-L-aspartic acidShow
YMDB00131Oleic acidShow
YMDB00143NADHShow
YMDB00312Acetyl-CoAShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00527palmitoyl-CoAShow
YMDB00528myristoyl-CoAShow
YMDB00530lauroyl-CoAShow
YMDB00531octanoyl-CoAShow
YMDB00532decanoyl-CoAShow
YMDB00533malonyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00676Caprylic acidShow
YMDB00677capric acidShow
YMDB00678lauric acidShow
YMDB00679myristic acidShow
YMDB00680Myristoleic acidShow
YMDB00681palmitoleic acidShow
YMDB00682stearic acidShow
YMDB00862hydronShow
YMDB00884Linoleic acidShow
YMDB00890waterShow
YMDB00912Carbon dioxideShow
GO Classification
Component
macromolecular complex
protein complex
fatty acid synthase complex
Function
catalytic activity
transferase activity
fatty acid synthase activity
oxidoreductase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
Process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
fatty acid biosynthetic process
metabolic process
cellular metabolic process
oxidation reduction
organic acid metabolic process
oxoacid metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL182W
Gene Sequence>6156 bp ATGGACGCTTACTCCACAAGACCATTAACCCTATCTCACGGTTCTTTAGAGCACGTGCTT CTGGTACCAACCGCTTCATTTTTCATTGCTTCGCAATTACAAGAACAATTTAATAAAATT TTGCCCGAACCCACTGAAGGGTTTGCTGCAGATGACGAGCCTACCACACCTGCTGAACTA GTGGGGAAATTCCTTGGCTACGTATCTTCTCTAGTCGAACCTTCCAAGGTCGGTCAATTC GATCAGGTCTTGAACCTTTGCTTAACAGAATTTGAAAACTGTTATTTAGAAGGCAATGAC ATTCACGCCTTGGCTGCTAAACTATTACAGGAAAACGACACAACTTTAGTGAAGACTAAA GAACTAATTAAAAATTATATTACCGCCAGAATAATGGCTAAGAGACCATTTGACAAAAAA TCCAACTCTGCTCTTTTTAGGGCCGTCGGCGAGGGTAACGCACAATTGGTAGCCATTTTC GGTGGTCAAGGTAACACCGACGACTACTTTGAAGAATTGCGTGATCTATATCAAACTTAT CATGTCTTAGTGGGAGATTTAATCAAGTTCTTCGCTGAAACTTTAAGTGAACTGATTAGA ACTACTTTAGATGCTGAAAAAGTCTTTACTCAAGGTTTAAACATATTGGAATGGTTGGAG AACCCTTCAAATACCCCAGACAAGGACTATTTACTTTCCATTCCAATTTCATGCCCCTTA ATTGGTGTCATTCAATTGGCTCACTACGTAGTTACTGCCAAGCTTTTGGGTTTCACTCCA GGTGAGTTAAGATCTTACTTAAAAGGTGCTACAGGTCACTCTCAAGGTTTGGTTACTGCT GTCGCCATAGCTGAGACGGATTCCTGGGAATCCTTCTTCGTCTCCGTAAGAAAAGCAATT ACTGTATTATTCTTCATCGGTGTTCGTTGTTACGAAGCATACCCAAACACTTCCCTACCA CCATCCATCTTGGAAGATTCCTTGGAAAACAATGAAGGTGTTCCATCTCCAATGTTGTCC ATTTCCAATCTAACTCAAGAACAAGTTCAAGACTATGTAAATAAGACTAACTCTCATTTG CCAGCTGGTAAACAAGTTGAAATTTCTCTAGTCAATGGTGCGAAGAATCTAGTCGTATCG GGCCCACCACAATCATTATATGGTTTAAACTTGACTTTAAGAAAGGCCAAGGCCCCATCT GGACTGGATCAATCAAGAATCCCATTCAGCGAAAGAAAATTGAAGTTCTCCAATAGGTTC TTACCTGTTGCATCACCATTCCATTCCCATCTATTGGTTCCAGCTTCAGATTTGATTAAC AAAGACTTAGTCAAAAACAATGTCAGCTTTAACGCTAAAGATATTCAAATCCCCGTTTAC GACACTTTTGATGGTTCAGATCTAAGAGTCCTTTCAGGTTCCATTTCCGAGAGAATCGTC GACTGCATCATTAGATTACCTGTCAAATGGGAAACTACTACACAATTCAAAGCCACCCAC ATATTAGACTTTGGTCCAGGTGGAGCTTCCGGTTTAGGTGTTTTAACCCATCGTAATAAA GATGGTACTGGTGTTCGTGTTATCGTTGCCGGTACTCTCGACATTAACCCAGATGATGAT TACGGATTCAAGCAAGAAATCTTTGATGTTACTAGTAATGGTTTGAAGAAAAATCCAAAC TGGTTGGAAGAATACCATCCAAAATTAATTAAGAACAAATCAGGCAAAATTTTTGTCGAA ACAAAATTTTCTAAATTAATCGGTAGACCACCTTTATTGGTTCCTGGTATGACACCATGT ACTGTTTCTCCAGATTTCGTAGCTGCTACCACAAATGCTGGTTATACCATTGAGTTGGCC GGTGGTGGTTACTTTTCCGCAGCAGGTATGACCGCCGCTATTGATTCTGTGGTTTCTCAG ATAGAAAAGGGTAGTACCTTCGGTATCAACTTGATCTACGTCAATCCATTTATGTTACAA TGGGGTATTCCATTAATCAAGGAACTAAGAAGCAAAGGTTATCCAATTCAATTCTTGACC ATTGGTGCTGGTGTCCCATCATTGGAAGTTGCTAGTGAATACATAGAGACATTAGGTTTG AAGTACTTGGGTTTGAAACCAGGTTCCATTGATGCTATTTCGCAAGTTATAAACATTGCT AAAGCACATCCAAACTTCCCAATAGCTTTACAATGGACCGGTGGTAGAGGTGGTGGTCAT CATTCTTTCGAAGATGCCCACACTCCAATGTTACAAATGTACTCCAAGATTAGAAGACAT CCAAACATTATGTTGATATTCGGTTCTGGTTTCGGTTCTGCTGATGACACTTACCCATAC TTAACCGGTGAATGGTCCACAAAATTCGATTATCCACCAATGCCATTCGATGGTTTCCTA TTTGGTTCGAGGGTCATGATTGCTAAGGAAGTTAAAACTTCTCCTGATGCTAAGAAGTGT ATTGCTGCTTGTACTGGTGTTCCTGATGATAAATGGGAACAAACCTACAAGAAGCCAACT GGTGGTATTGTCACTGTTCGCTCTGAAATGGGTGAACCAATTCACAAAATTGCCACTCGT GGTGTTATGCTATGGAAGGAATTCGACGAAACCATCTTCAACTTACCAAAGAATAAGTTG GTACCAACTTTGGAAGCAAAGAGAGATTACATTATCTCAAGATTGAACGCCGATTTCCAA AAACCATGGTTTGCTACCGTCAACGGTCAAGCCCGTGACCTAGCCACAATGACATACGAA GAAGTTGCAAAGAGATTGGTGGAATTAATGTTCATCAGATCTACCAACTCTTGGTTTGAT GTCACATGGAGAACCTTTACTGGTGATTTCCTACGTCGTGTCGAAGAACGTTTCACTAAA AGTAAGACATTGTCTTTAATCCAATCCTATTCTCTACTAGACAAGCCTGATGAAGCTATT GAAAAAGTATTTAATGCTTATCCTGCCGCTAGGGAACAGTTCTTGAATGCGCAAGATATT GATCACTTTTTGAGCATGTGTCAAAATCCAATGCAAAAACCAGTGCCTTTTGTTCCAGTT TTGGATCGTAGATTCGAGATTTTTTTCAAAAAAGATTCGTTATGGCAATCTGAGCAATTG GAAGCCGTCGTCGACCAAGACGTTCAAAGAACATGTATCCTACATGGACCTGTTGCAGCA CAATTCACTAAAGTCATCGATGAACCAATTAAGAGCATTATGGATGGTATTCACGATGGT CACATCAAAAAGTTACTACATCAATATTACGGTGACGATGAGTCAAAGATTCCAGCAGTT GAGTACTTTGGTGGTGAAAGCCCTGTAGACGTACAAAGTCAAGTTGATTCTTCCTCTGTA TCTGAAGACTCAGCTGTTTTTAAGGCAACATCCTCTACTGATGAAGAAAGCTGGTTTAAG GCTTTGGCGGGATCCGAAATTAACTGGAGACATGCAAGTTTCTTATGTTCCTTTATCACT CAAGATAAAATGTTTGTTTCTAACCCAATTAGAAAAGTTTTCAAGCCAAGCCAAGGAATG GTTGTTGAGTTTTCCAACGGCAATACTTCTTCAAAGACTGTTGTCACTCTTTCAGAACCT GTTCAAGGTGAATTGAAACCAACTGTTATTTTGAAGTTGTTGAAGGAGAACATAATCCAA ATGGAAATGATTGAGAACAGAACTATGGATGGTAAGCCCGTCAGCTTGCCATTGTTGTAC AACTTCAACCCAGATAATGGTTTTGCTCCAATCTCTGAAGTTATGGAGGACAGAAACCAA AGAATTAAGGAAATGTACTGGAAATTATGGATTGATGAGCCTTTCAATTTGGACTTTGAC CCAAGAGATGTCATTAAGGGCAAAGATTTCGAGATCACCGCTAAAGAAGTTTATGACTTT ACACACGCTGTTGGAAACAATTGTGAAGACTTCGTTTCTAGACCTGATAGAACGATGTTG GCCCCAATGGACTTTGCTATTGTTGTCGGATTGAGAGGCATCATCAAGGCCATTTTCCCT AATACGGTCGATGGTGACTTATTGAAGTTGGTTCATTTGTCTAACGGCTACAAGATGATT CCTGGCGCTAAGCCACTGCAAGTTGGTGATGTTGTTTCAACTACTGCTGTTATTGAATCT GTCGTCAACCAACCTACAGGAAAGATTGTCGATGTGGTAGGTACATTATCGAGAAATGGC AAGCCTGTCATGGAAGTCACCTCCTCATTCTTCTACAGAGGCAACTATACTGACTTTGAA AACACTTTCCAAAAGACTGTTGAACCTGTTTATCAAATGCACATCAAAACTTCTAAAGAT ATAGCTGTCTTGCGCTCTAAGGAGTGGTTCCAATTGGACGATGAAGACTTCGATCTGTTA AACAAAACTTTGACTTTCGAAACTGAAACTGAAGTTACTTTCAAGAATGCTAACATCTTC TCTTCAGTGAAATGTTTTGGCCCAATTAAAGTTGAATTGCCAACCAAAGAAACCGTGGAG ATCGGTATTGTCGATTACGAAGCCGGTGCCTCTCACGGTAACCCTGTTGTTGATTTCTTG AAGAGAAACGGTTCCACATTGGAACAAAAGGTCAATCTAGAAAATCCTATTCCAATTGCA GTACTTGATTCGTACACTCCAAGTACCAACGAACCATACGCTAGAGTTTCTGGTCATTTG AATCCAATTCACGTTTCACGTCATTTTGCCTCTTACGCAAACTTGCCAGGTACTATCACG CACGGTATGTTTTCTTCTGCTTCCGTCCGTGCTTTGATTGAAAACTGGGCTGCTGACAGT GTTTCATCCAGGGTACGTGGCTACACTTGTCAATTTGTTGACATGGTTTTGCCTAACACT GCTTTGAAAACATCGATTCAACATGTTGGTATGATCAATGGTAGAAAATTGATAAAGTTT GAAACTAGAAATGAAGATGACGTTGTAGTTTTGACTGGTGAAGCCGAAATTGAACAACCT GGTACTACCTTCGTTTTCACTGGTCAAGGTTCACAAGAACAAGGTATGGGTATGGACTTA TACAAAACTTCTAAAGCTGCTCAAGATGTTTGGAATAGAGCTGACAACCATTTCAAGGAC ACTTATGGTTTCTCTATCTTAGACATTGTCATTAACAACCCAGTTAACTTAACAATTCAC TTCGGTGGTGAAAAGGGTAAGAGGATCAGAGAAAACTATTCTGCTATGATCTTTGAGACT ATCGTGGATGGAAAATTGAAGACTGAAAAAATTTTCAAGGAAATTAATGAGCACAGTACT TCTTACACATTTAGATCTGAAAAAGGTTTATTGTCTGCTACTCAATTTACACAACCAGCT TTAACTTTGATGGAAAAAGCTGCTTTCGAAGACTTGAAATCTAAAGGTTTGATCCCAGCC GATGCTACTTTTGCTGGTCACTCTTTAGGTGAGTATGCTGCTTTGGCCTCTTTGGCTGAT GTTATGTCTATCGAATCTTTAGTTGAAGTTGTGTTCTACAGAGGTATGACTATGCAAGTT GCTGTTCCAAGAGATGAGTTGGGCAGATCCAACTATGGTATGATTGCCATTAACCCAGGT AGAGTCGCTGCATCATTCTCTCAAGAAGCTTTGCAATATGTTGTTGAGAGAGTTGGTAAG AGAACCGGCTGGTTGGTTGAAATCGTCAACTACAACGTTGAAAACCAACAATATGTTGCA GCTGGTGATCTAAGAGCTTTAGACACCGTTACCAATGTTCTAAACTTCATCAAATTACAA AAAATTGATATTATTGAACTACAAAAGTCCTTATCTTTGGAAGAAGTTGAAGGTCATTTG TTTGAGATCATTGACGAAGCTTCCAAGAAATCTGCTGTCAAGCCTCGCCCACTTAAATTG GAGAGAGGTTTTGCTTGTATCCCATTAGTTGGTATTTCTGTTCCTTTCCATTCCACCTAC TTGATGAATGGTGTTAAACCATTCAAGAGTTTCTTGAAGAAGAATATCATAAAAGAAAAT GTGAAGGTTGCTAGATTGGCCGGAAAGTACATTCCAAACTTGACTGCAAAACCATTCCAG GTTACTAAGGAATATTTCCAGGACGTTTATGATTTGACTGGCTCCGAACCTATCAAGGAA ATCATCGACAACTGGGAAAAGTATGAACAATCCTAA
Protein Properties
Pfam Domain Function
Protein Residues2051
Protein Molecular Weight228689.0
Protein Theoretical pI5.73
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fatty acid synthase subunit beta MDAYSTRPLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAEL VGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTK ELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTDDYFEELRDLYQTY HVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPL IGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAI TVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHL PAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRF LPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSISERIV DCIIRLPVKWETTTQFKATHILDFGPGGASGLGVLTHRNKDGTGVRVIVAGTLDINPDDD YGFKQEIFDVTSNGLKKNPNWLEEYHPKLIKNKSGKIFVETKFSKLIGRPPLLVPGMTPC TVSPDFVAATTNAGYTIELAGGGYFSAAGMTAAIDSVVSQIEKGSTFGINLIYVNPFMLQ WGIPLIKELRSKGYPIQFLTIGAGVPSLEVASEYIETLGLKYLGLKPGSIDAISQVINIA KAHPNFPIALQWTGGRGGGHHSFEDAHTPMLQMYSKIRRHPNIMLIFGSGFGSADDTYPY LTGEWSTKFDYPPMPFDGFLFGSRVMIAKEVKTSPDAKKCIAACTGVPDDKWEQTYKKPT GGIVTVRSEMGEPIHKIATRGVMLWKEFDETIFNLPKNKLVPTLEAKRDYIISRLNADFQ KPWFATVNGQARDLATMTYEEVAKRLVELMFIRSTNSWFDVTWRTFTGDFLRRVEERFTK SKTLSLIQSYSLLDKPDEAIEKVFNAYPAAREQFLNAQDIDHFLSMCQNPMQKPVPFVPV LDRRFEIFFKKDSLWQSEHLEAVVDQDVQRTCILHGPVAAQFTKVIDEPIKSIMDGIHDG HIKKLLHQYYGDDESKIPAVEYFGGESPVDVQSQVDSSSVSEDSAVFKATSSTDEESWFK ALAGSEINWRHASFLCSFITQDKMFVSNPIRKVFKPSQGMVVEISNGNTSSKTVVTLSEP VQGELKPTVILKLLKENIIQMEMIENRTMDGKPVSLPLLYNFNPDNGFAPISEVMEDRNQ RIKEMYWKLWIDEPFNLDFDPRDVIKGKDFEITAKEVYDFTHAVGNNCEDFVSRPDRTML APMDFAIVVGWRAIIKAIFPNTVDGDLLKLVHLSNGYKMIPGAKPLQVGDVVSTTAVIES VVNQPTGKIVDVVGTLSRNGKPVMEVTSSFFYRGNYTDFENTFQKTVEPVYQMHIKTSKD IAVLRSKEWFQLDDEDFDLLNKTLTFETETEVTFKNANIFSSVKCFGPIKVELPTKETVE IGIVDYEAGASHGNPVVDFLKRNGSTLEQKVNLENPIPIAVLDSYTPSTNEPYARVSGDL NPIHVSRHFASYANLPGTITHGMFSSASVRALIENWAADSVSSRVRGYTCQFVDMVLPNT ALKTSIQHVGMINGRKLIKFETRNEDDVVVLTGEAEIEQPVTTFVFTGQGSQEQGMGMDL YKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFET IVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPA DATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDELGRSNYGMIAINPG RVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGDLRALDTVTNVLNFIKLQ KIDIIELQKSLSLEEVEGHLFEIIDEASKKSAVKPRPLKLERGFACIPLVGISVPFHSTY LMNGVKPFKSFLKKNIIKENVKVARLAGKYIPNLTAKPFQVTKEYFQDVYDLTGSEPIKE IIDNWEKYEQS
References
External Links
ResourceLink
Saccharomyces Genome Database FAS1
Uniprot IDP07149
Uniprot NameFAS1_YEAST
GenBank Gene IDM30162
Genebank Protein ID171500
General Reference
  • Schweizer, M., Roberts, L. M., Holtke, H. J., Takabayashi, K., Hollerer, E., Hoffmann, B., Muller, G., Kottig, H., Schweizer, E. (1986). "The pentafunctional FAS1 gene of yeast: its nucleotide sequence and order of the catalytic domains." Mol Gen Genet 203:479-486.3528750
  • Kottig, H., Rottner, G., Beck, K. F., Schweizer, M., Schweizer, E. (1991). "The pentafunctional FAS1 genes of Saccharomyces cerevisiae and Yarrowia lipolytica are co-linear and considerably longer than previously estimated." Mol Gen Genet 226:310-314.2034224
  • Chirala, S. S., Kuziora, M. A., Spector, D. M., Wakil, S. J. (1987). "Complementation of mutations and nucleotide sequence of FAS1 gene encoding beta subunit of yeast fatty acid synthase." J Biol Chem 262:4231-4240.3031066
  • Wiemann, S., Voss, H., Schwager, C., Rupp, T., Stegemann, J., Zimmermann, J., Grothues, D., Sensen, C., Erfle, H., Hewitt, N., et, a. l. .. (1993). "Sequencing and analysis of 51.6 kilobases on the left arm of chromosome XI from Saccharomyces cerevisiae reveals 23 open reading frames including the FAS1 gene." Yeast 9:1343-1348.8154185
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Carter, A. T., Narbad, A., Pearson, B. M., Beck, K. F., Logghe, M., Contreras, R., Schweizer, M. (1994). "Phosphoribosylpyrophosphate synthetase (PRS): a new gene family in Saccharomyces cerevisiae." Yeast 10:1031-1044.7992503
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956