You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
| Identification |
|---|
| Name | NADPH-dependent aldose reductase GRE3 |
|---|
| Synonyms | - Genes de respuesta a estres protein 3
- NADPH-dependent aldo-keto reductase GRE3
- NADPH-dependent methylglyoxal reductase GRE3
- Xylose reductase
|
|---|
| Gene Name | GRE3 |
|---|
| Enzyme Class | |
|---|
| Biological Properties |
|---|
| General Function | Involved in oxidoreductase activity |
|---|
| Specific Function | Reduces the cytotoxic compound methylglyoxal (MG) to (R)-lactaldehyde similar to GRE2. MG is synthesized via a bypath of glycolysis from dihydroxyacetone phosphate and is believed to play a role in cell cycle regulation and stress adaptation. In pentose-fermenting yeasts, aldose reductase catalyzes the reduction of xylose into xylitol. The purified enzyme catalyzes this reaction, but the inability of S.cerevisiae to grow on xylose as sole carbon source indicates that the physiological function is more likely methylglyoxal reduction |
|---|
| Cellular Location | Cytoplasm. Nucleus |
|---|
| SMPDB Pathways | |
|---|
| KEGG Pathways | |
|---|
| SMPDB Reactions | |
|---|
| KEGG Reactions | |
|---|
| Metabolites | | YMDB ID | Name | View |
|---|
| YMDB00111 | D-Lactaldehyde | Show | | YMDB00167 | Lactaldehyde | Show | | YMDB00170 | Pyruvaldehyde | Show | | YMDB00283 | Glycerol | Show | | YMDB00286 | D-Glucose | Show | | YMDB00373 | D-Xylitol | Show | | YMDB00426 | NADPH | Show | | YMDB00427 | NADP | Show | | YMDB00575 | D-glyceraldehyde | Show | | YMDB00591 | L-arabinitol | Show | | YMDB00656 | D-glucitol | Show | | YMDB00778 | Xylitol | Show | | YMDB00779 | aldehydo-D-Xylose | Show | | YMDB00862 | hydron | Show | | YMDB00893 | L-Arabinose | Show |
|
|---|
| GO Classification | | Component |
|---|
| Not Available | | Function |
|---|
| oxidoreductase activity | | catalytic activity | | Process |
|---|
| oxidation reduction | | metabolic process |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | chromosome 8 |
|---|
| Locus | YHR104W |
|---|
| Gene Sequence | >984 bp
ATGTCTTCACTGGTTACTCTTAATAACGGTCTGAAAATGCCCCTAGTCGGCTTAGGGTGC
TGGAAAATTGACAAAAAAGTCTGTGCGAATCAAATTTATGAAGCTATCAAATTAGGCTAC
CGTTTATTCGATGGTGCTTGCGACTACGGCAACGAAAAGGAAGTTGGTGAAGGTATCAGG
AAAGCCATCTCCGAAGGTCTTGTTTCTAGAAAGGATATATTTGTTGTTTCAAAGTTATGG
AACAATTTTCACCATCCTGATCATGTAAAATTAGCTTTAAAGAAGACCTTAAGCGATATG
GGACTTGATTATTTAGACCTGTATTATATTCACTTCCCAATCGCCTTCAAATATGTTCCA
TTTGAAGAGAAATACCCTCCAGGATTCTATACGGGCGCAGATGACGAGAAGAAAGGTCAC
ATCACCGAAGCACATGTACCAATCATAGATACGTACCGGGCTCTGGAAGAATGTGTTGAT
GAAGGCTTGATTAAGTCTATTGGTGTTTCCAACTTTCAGGGAAGCTTGATTCAAGATTTA
TTACGTGGTTGTAGAATCAAGCCCGTGGCTTTGCAAATTGAACACCATCCTTATTTGACT
CAAGAACACCTAGTTGAGTTTTGTAAATTACACGATATCCAAGTAGTTGCTTACTCCTCC
TTCGGTCCTCAATCATTCATTGAGATGGACTTACAGTTGGCAAAAACCACGCCAACTCTG
TTCGAGAATGATGTAATCAAGAAGGTCTCACAAAACCATCCAGGCAGTACCACTTCCCAA
GTATTGCTTAGATGGGCAACTCAGAGAGGCATTGCCGTCATTCCAAAATCTTCCAAGAAG
GAAAGGTTACTTGGCAACCTAGAAATCGAAAAAAAGTTCACTTTAACGGAGCAAGAATTG
AAGGATATTTCTGCACTAAATGCCAACATCAGATTTAATGATCCATGGACCTGGTTGGAT
GGTAAATTCCCCACTTTTGCCTGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | |
|---|
| Protein Residues | 327 |
|---|
| Protein Molecular Weight | 37118.5 |
|---|
| Protein Theoretical pI | 7.09 |
|---|
| Signalling Regions | |
|---|
| Transmembrane Regions | |
|---|
| Protein Sequence | >NADPH-dependent aldose reductase GRE3
MSSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIR
KAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVP
FEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDL
LRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTL
FENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQEL
KDISALNANIRFNDPWTWLDGKFPTFA |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | - Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
- Garay-Arroyo, A., Covarrubias, A. A. (1999). "Three genes whose expression is induced by stress in Saccharomyces cerevisiae." Yeast 15:879-892.10407268
- Aguilera, J., Prieto, J. A. (2001). "The Saccharomyces cerevisiae aldose reductase is implied in the metabolism of methylglyoxal in response to stress conditions." Curr Genet 39:273-283.11525399
- Traff, K. L., Otero Cordero, R. R., van Zyl, W. H., Hahn-Hagerdal, B. (2001). "Deletion of the GRE3 aldose reductase gene and its influence on xylose metabolism in recombinant strains of Saccharomyces cerevisiae expressing the xylA and XKS1 genes." Appl Environ Microbiol 67:5668-5674.11722921
- Lee, H. (1998). "The structure and function of yeast xylose (aldose) reductases." Yeast 14:977-984.9730277
- Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
- Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
- Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
|
|---|