You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcetyl-CoA carboxylase
Synonyms
  • ACC
  • Biotin carboxylase
Gene NameFAS3
Enzyme Class
Biological Properties
General FunctionInvolved in acetyl-CoA carboxylase activity
Specific FunctionCarries out three functions:biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase
Cellular LocationCytoplasm
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
Fatty acid biosynthesisPW002458 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fatty acid biosynthesisec00061 Map00061
Propanoate metabolismec00640 Map00640
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Adenosine triphosphate + Pyruvic acid + Hydrogen carbonateADP + phosphate + Oxalacetic acid
Acetyl-CoA + Adenosine triphosphate + Hydrogen carbonateADP + Pyrophosphate + malonyl-CoA
KEGG Reactions
Carbonic acid + Adenosine triphosphate + Acetyl-CoAphosphate + malonyl-CoA + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00175Pyruvic acidShow
YMDB00219PyrophosphateShow
YMDB00235Oxalacetic acidShow
YMDB00312Acetyl-CoAShow
YMDB00382Carbonic acidShow
YMDB00533malonyl-CoAShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00912Carbon dioxideShow
YMDB00914ADPShow
YMDB16118Hydrogen carbonateShow
GO Classification
Component
Not Available
Function
vitamin binding
biotin binding
catalytic activity
ligase activity
ligase activity, forming carbon-carbon bonds
CoA carboxylase activity
acetyl-CoA carboxylase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
Process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
metabolic process
fatty acid metabolic process
fatty acid biosynthetic process
cellular metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYNR016C
Gene Sequence>6702 bp ATGAGCGAAGAAAGCTTATTCGAGTCTTCTCCACAGAAGATGGAGTACGAAATTACAAAC TACTCAGAAAGACATACAGAACTTCCAGGTCATTTCATTGGCCTCAATACAGTAGATAAA CTAGAGGAGTCCCCGTTAAGGGACTTTGTTAAGAGTCACGGTGGTCACACGGTCATATCC AAGATCCTGATAGCAAATAATGGTATTGCCGCCGTGAAAGAAATTAGATCCGTCAGAAAA TGGGCATACGAGACGTTCGGCGATGACAGAACCGTCCAATTCGTCGCCATGGCCACCCCA GAAGATCTGGAGGCCAACGCAGAATATATCCGTATGGCCGATCAATACATTGAAGTGCCA GGTGGTACTAATAATAACAACTACGCTAACGTAGACTTGATCGTAGACATCGCCGAAAGA GCAGACGTAGACGCCGTATGGGCTGGCTGGGGTCACGCCTCCGAGAATCCACTATTGCCT GAAAAATTGTCCCAGTCTAAGAGGAAAGTCATCTTTATTGGGCCTCCAGGTAACGCCATG AGGTCTTTAGGTGATAAAATCTCCTCTACCATTGTCGCTCAAAGTGCTAAAGTCCCATGT ATTCCATGGTCTGGTACCGGTGTTGACACCGTTCACGTGGACGAGAAAACCGGTCTGGTC TCTGTCGACGATGACATCTATCAAAAGGGTTGTTGTACCTCTCCTGAAGATGGTTTACAA AAGGCCAAGCGTATTGGTTTTCCTGTCATGATTAAGGCATCCGAAGGTGGTGGTGGTAAA GGTATCAGACAAGTTGAACGTGAAGAAGATTTCATCGCTTTATACCACCAGGCAGCCAAC GAAATTCCAGGCTCCCCCATTTTCATCATGAAGTTGGCCGGTAGAGCGCGTCACTTGGAA GTTCAACTGCTAGCAGATCAGTACGGTACAAATATTTCCTTGTTCGGTAGAGACTGTTCC GTTCAGAGACGTCATCAAAAAATTATCGAAGAAGCACCAGTTACAATTGCCAAGGCTGAA ACATTTCACGAGATGGAAAAGGCTGCCGTCAGACTGGGGAAACTAGTCGGTTATGTCTCT GCCGGTACCGTGGAGTATCTATATTCTCATGATGATGGAAAATTCTACTTTTTAGAATTG AACCCAAGATTACAAGTCGAGCATCCAACAACGGAAATGGTCTCCGGTGTTAACTTACCT GCAGCTCAATTACAAATCGCTATGGGTATCCCTATGCATAGAATAAGTGACATTAGAACT TTATATGGTATGAATCCTCATTCTGCCTCAGAAATCGATTTCGAATTCAAAACTCAAGAT GCCACCAAGAAACAAAGAAGACCTATTCCAAAGGGTCATTGTACCGCTTGTCGTATCACA TCAGAAGATCCAAACGATGGATTCAAGCCATCGGGTGGTACTTTGCATGAACTAAACTTC CGTTCTTCCTCTAATGTTTGGGGTTACTTCTCCGTGGGTAACAATGGTAATATTCACTCC TTTTCGGACTCTCAGTTCGGCCATATTTTTGCTTTTGGTGAAAATAGACAAGCTTCCAGG AAACACATGGTTGTTGCCCTGAAGGAATTGTCCATTAGGGGTGATTTCAGAACTACTGTG GAATACTTGATCAAACTTTTGGAAACTGAAGATTTCGAGGATAACACTATTACCACCGGT TGGTTGGACGATTTGATTACTCATAAAATGACCGCTGAAAAGCCTGATCCAACTCTTGCC GTCATTTGCGGTGCCGCTACAAAGGCTTTCTTAGCATCTGAAGAAGCCCGCCACAAGTAT ATCGAATCCTTACAAAAGGGACAAGTTCTATCTAAAGACCTACTGCAAACTATGTTCCCT GTAGATTTTATCCATGAGGGTAAAAGATACAAGTTCACCGTAGCTAAATCCGGTAATGAC CGTTACACATTATTTATCAATGGTTCTAAATGTGATATCATACTGCGTCAACTATCTGAT GGTGGTCTTTTGATTGCCATAGGCGGTAAATCGCATACCATCTATTGGAAAGAAGAAGTT GCTGCTACAAGATTATCCGTTGACTCTATGACTACTTTGTTGGAAGTTGAAAACGATCCA ACCCAGTTGCGTACTCCATCCCCTGGTAAATTGGTTAAATTCTTGGTGGAAAATGGTGAA CACATTATCAAGGGCCAACCATATGCAGAAATTGAAGTTATGAAAATGCAAATGCCTTTG GTTTCTCAAGAAAATGGTATCGTCCAGTTATTAAAGCAACCTGGTTCTACCATTGTTGCA GGTGATATCATGGCTATTATGACTCTTGACGATCCATCCAAGGTCAAGCACGCTCTACCA TTTGAAGGTATGCTGCCAGATTTTGGTTCTCCAGTTATCGAAGGAACCAAACCTGCCTAT AAATTCAAGTCATTAGTGTCTACTTTGGAAAACATTTTGAAGGGTTATGACAACCAAGTT ATTATGAACGCTTCCTTGCAACAATTGATAGAGGTTTTGAGAAATCCAAAACTGCCTTAC TCAGAATGGAAACTACACATCTCTGCTTTACATTCAAGATTGCCTGCTAAGCTAGATGAA CAAATGGAAGAGTTAGTTGCACGTTCTTTGAGACGTGGTGCTGTTTTCCCAGCTAGACAA TTAAGTAAATTGATTGATATGGCCGTGAAGAATCCTGAATACAACCCCGACAAATTGCTG GGCGCCGTCGTGGAACCATTGGCGGATATTGCTCATAAGTACTCTAACGGGTTAGAAGCC CATGAACATTCTATATTTGTCCATTTCTTGGAAGAATATTACGAAGTTGAAAAGTTATTC AATGGTCCAAATGTTCGTGAGGAAAATATCATTCTGAAATTGCGTGATGAAAACCCTAAA GATCTAGATAAAGTTGCGCTAACTGTTTTGTCTCATTCGAAAGTTTCAGCGAAGAATAAC CTGATCCTAGCTATCTTGAAACATTATCAACCATTGTGCAAGTTATCTTCTAAAGTTTCT GCCATTTTCTCTACTCCTCTACAACATATTGTTGAACTAGAATCTAAGGCTACCGCTAAG GTCGCTCTACAAGCAAGAGAAATTTTGATTCAAGGCGCTTTACCTTCGGTCAAGGAAAGA ACTGAACAAATTGAACATATCTTAAAATCCTCTGTTGTGAAGGTTGCCTATGGCTCATCC AATCCAAAGCGCTCTGAACCAGATTTGAATATCTTGAAGGACTTGATCGATTCTAATTAC GTTGTGTTCGATGTTTTACTTCAATTCCTAACCCATCAAGACCCAGTTGTGACTGCTGCA GCTGCTCAAGTCTATATTCGTCGTGCTTATCGTGCTTACACCATAGGAGATATTAGAGTT CACGAAGGTGTCACAGTTCCAATTGTTGAATGGAAATTCCAACTACCTTCAGCTGCGTTC TCCACCTTTCCAACTGTTAAATCTAAAATGGGTATGAACAGGGCTGTTTCTGTTTCAGAT TTGTCATATGTTGCAAACAGTCAGTCATCTCCGTTAAGAGAAGGTATTTTGATGGCTGTG GATCATTTAGATGATGTTGATGAAATTTTGTCACAAAGTTTGGAAGTTATTCCTCGTCAC CAATCTTCTTCTAACGGACCTGCTCCTGATCGTTCTGGTAGCTCCGCATCGTTGAGTAAT GTTGCTAATGTTTGTGTTGCTTCTACAGAAGGTTTCGAATCTGAAGAGGAAATTTTGGTA AGGTTGAGAGAAATTTTGGATTTGAATAAGCAGGAATTAATCAATGCTTCTATCCGTCGT ATCACATTTATGTTCGGTTTTAAAGATGGGTCTTATCCAAAGTATTATACTTTTAACGGT CCAAATTATAACGAAAATGAAACAATTCGTCACATTGAGCCGGCTTTGGCCTTCCAACTG GAATTAGGAAGATTGTCCAACTTCAACATTAAACCAATTTTCACTGATAATAGAAACATC CATGTCTACGAAGCTGTTAGTAAGACTTCTCCATTGGATAAGAGATTCTTTACAAGAGGT ATTATTAGAACGGGTCATATCCGTGATGACATTTCTATTCAAGAATATCTGACTTCTGAA GCTAACAGATTGATGAGTGATATATTGGATAATTTAGAAGTCACCGACACTTCAAATTCT GATTTGAATCATATCTTCATCAACTTCATTGCGGTGTTTGATATCTCTCCAGAAGATGTC GAAGCCGCCTTCGGTGGTTTCTTAGAAAGATTTGGTAAGAGATTGTTGAGATTGCGTGTT TCTTCTGCCGAAATTAGAATCATCATCAAAGATCCTCAAACAGGTGCCCCAGTACCATTG CGTGCCTTGATCAATAACGTTTCTGGTTATGTTATCAAAACAGAAATGTACACCGAAGTC AAGAACGCAAAAGGTGAATGGGTATTTAAGTCTTTGGGTAAACCTGGATCCATGCATTTA AGACCTATTGCTACTCCTTACCCTGTTAAGGAATGGTTGCAACCAAAACGTTATAAGGCA CACTTGATGGGTACCACATATGTCTATGACTTCCCAGAATTATTCCGCCAAGCATCGTCA TCCCAATGGAAAAATTTCTCTGCAGATGTTAAGTTAACAGATGATTTCTTTATTTCCAAC GAGTTGATTGAAGATGAAAACGGCGAATTAACTGAGGTGGAAAGAGAACCTGGTGCCAAC GCTATTGGTATGGTTGCCTTTAAGATTACTGTAAAGACTCCTGAATATCCAAGAGGCCGT CAATTTGTTGTTGTTGCTAACGATATCACATTCAAGATCGGTTCCTTTGGTCCACAAGAA GACGAATTCTTCAATAAGGTTACTGAATATGCTAGAAAGCGTGGTATCCCAAGAATTTAC TTGGCTGCAAACTCAGGTGCCAGAATTGGTATGGCTGAAGAGATTGTTCCACTATTTCAA GTTGCATGGAATGATGCTGCCAATCCGGACAAGGGCTTCCAATACTTATACTTAACAAGT GAAGGTATGGAAACTTTAAAGAAATTTGACAAAGAAAATTCTGTTCTCACTGAACGTACT GTTATAAACGGTGAAGAAAGATTTGTCATCAAGACAATTATTGGTTCTGAAGATGGGTTA GGTGTCGAATGTCTACGTGGATCTGGTTTAATTGCTGGTGCAACGTCAAGGGCTTACCAC GATATCTTCACTATCACCTTAGTCACTTGTAGATCCGTCGGTATCGGTGCTTATTTGGTT CGTTTGGGTCAAAGAGCTATTCAGGTCGAAGGCCAGCCAATTATTTTAACTGGTGCTCCT GCAATCAACAAAATGCTGGGTAGAGAAGTTTATACTTCTAACTTACAATTGGGTGGTACT CAAATCATGTATAACAACGGTGTTTCACATTTGACTGCTGTTGACGATTTAGCTGGTGTA GAGAAGATTGTTGAATGGATGTCTTATGTTCCAGCCAAGCGTAATATGCCAGTTCCTATC TTGGAAACTAAAGACACATGGGATAGACCAGTTGATTTCACTCCAACTAATGATGAAACT TACGATGTAAGATGGATGATTGAAGGTCGTGAGACTGAAAGTGGATTTGAATATGGTTTG TTTGATAAAGGGTCTTTCTTTGAAACTTTGTCAGGATGGGCCAAAGGTGTTGTCGTTGGT AGAGCCCGTCTTGGTGGTATTCCACTGGGTGTTATTGGTGTTGAAACAAGAACTGTCGAG AACTTGATTCCTGCTGATCCAGCTAATCCAAATAGTGCTGAAACATTAATTCAAGAACCT GGTCAAGTTTGGCATCCAAACTCCGCCTTCAAGACTGCTCAAGCTATCAATGACTTTAAC AACGGTGAACAATTGCCAATGATGATTTTGGCCAACTGGAGAGGTTTCTCTGGTGGTCAA CGTGATATGTTCAACGAAGTCTTGAAGTATGGTTCGTTTATTGTTGACGCATTGGTGGAT TACAAACAACCAATTATTATCTATATCCCACCTACCGGTGAACTAAGAGGTGGTTCATGG GTTGTTGTCGATCCAACTATCAACGCTGACCAAATGGAAATGTATGCCGACGTCAACGCT AGAGCTGGTGTTTTGGAACCACAAGGTATGGTTGGTATCAAGTTCCGTAGAGAAAAATTG CTGGACACCATGAACAGATTGGATGACAAGTACAGAGAATTGAGATCTCAATTATCCAAC AAGAGTTTGGCTCCAGAAGTACATCAGCAAATATCCAAGCAATTAGCTGATCGTGAGAGA GAACTATTGCCAATTTACGGACAAATCAGTCTTCAATTTGCTGATTTGCACGATAGGTCT TCACGTATGGTGGCCAAGGGTGTTATTTCTAAGGAACTGGAATGGACCGAGGCACGTCGT TTCTTCTTCTGGAGATTGAGAAGAAGATTGAACGAAGAATATTTGATTAAAAGGTTGAGC CATCAGGTAGGCGAAGCATCAAGATTAGAAAAGATCGCAAGAATTAGATCGTGGTACCCT GCTTCAGTGGACCATGAAGATGATAGGCAAGTCGCAACATGGATTGAAGAAAACTACAAA ACTTTGGACGATAAACTAAAGGGTTTGAAATTAGAGTCATTCGCTCAAGACTTAGCTAAA AAGATCAGAAGCGACCATGACAATGCTATTGATGGATTATCTGAAGTTATCAAGATGTTA TCTACCGATGATAAAGAAAAATTGTTGAAGACTTTGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues2233
Protein Molecular Weight250351.0
Protein Theoretical pI6.21
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Acetyl-CoA carboxylase MSEESLFESSPQKMEYEITNYSERHTELPGHFIGLNTVDKLEESPLRDFVKSHGGHTVIS KILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVP GGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAM RSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQ KAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGSPIFIMKLAGRARHLE VQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVGYVS AGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRISDIRT LYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFKPSGGTLHELNF RSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTV EYLIKLLETEDFEDNTITTGWLDDLITHKMTAEKPDPTLAVICGAATKAFLASEEARHKY IESLQKGQVLSKDLLQTMFPVDFIHEGKRYKFTVAKSGNDRYTLFINGSKCDIILRQLSD GGLLIAIGGKSHTIYWKEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGE HIIKGQPYAEIEVMKMQMPLVSQENGIVQLLKQPGSTIVAGDIMAIMTLDDPSKVKHALP FEGMLPDFGSPVIEGTKPAYKFKSLVSTLENILKGYDNQVIMNASLQQLIEVLRNPKLPY SEWKLHISALHSRLPAKLDEQMEELVARSLRRGAVFPARQLSKLIDMAVKNPEYNPDKLL GAVVEPLADIAHKYSNGLEAHEHSIFVHFLEEYYEVEKLFNGPNVREENIILKLRDENPK DLDKVALTVLSHSKVSAKNNLILAILKHYQPLCKLSSKVSAIFSTPLQHIVELESKATAK VALQAREILIQGALPSVKERTEQIEHILKSSVVKVAYGSSNPKRSEPDLNILKDLIDSNY VVFDVLLQFLTHQDPVVTAAAAQVYIRRAYRAYTIGDIRVHEGVTVPIVEWKFQLPSAAF STFPTVKSKMGMNRAVSVSDLSYVANSQSSPLREGILMAVDHLDDVDEILSQSLEVIPRH QSSSNGPAPDRSGSSASLSNVANVCVASTEGFESEEEILVRLREILDLNKQELINASIRR ITFMFGFKDGSYPKYYTFNGPNYNENETIRHIEPALAFQLELGRLSNFNIKPIFTDNRNI HVYEAVSKTSPLDKRFFTRGIIRTGHIRDDISIQEYLTSEANRLMSDILDNLEVTDTSNS DLNHIFINFIAVFDISPEDVEAAFGGFLERFGKRLLRLRVSSAEIRIIIKDPQTGAPVPL RALINNVSGYVIKTEMYTEVKNAKGEWVFKSLGKPGSMHLRPIATPYPVKEWLQPKRYKA HLMGTTYVYDFPELFRQASSSQWKNFSADVKLTDDFFISNELIEDENGELTEVEREPGAN AIGMVAFKITVKTPEYPRGRQFVVVANDITFKIGSFGPQEDEFFNKVTEYARKRGIPRIY LAANSGARIGMAEEIVPLFQVAWNDAANPDKGFQYLYLTSEGMETLKKFDKENSVLTERT VINGEERFVIKTIIGSEDGLGVECLRGSGLIAGATSRAYHDIFTITLVTCRSVGIGAYLV RLGQRAIQVEGQPIILTGAPAINKMLGREVYTSNLQLGGTQIMYNNGVSHLTAVDDLAGV EKIVEWMSYVPAKRNMPVPILETKDTWDRPVDFTPTNDETYDVRWMIEGRETESGFEYGL FDKGSFFETLSGWAKGVVVGRARLGGIPLGVIGVETRTVENLIPADPANPNSAETLIQEP GQVWHPNSAFKTAQAINDFNNGEQLPMMILANWRGFSGGQRDMFNEVLKYGSFIVDALVD YKQPIIIYIPPTGELRGGSWVVVDPTINADQMEMYADVNARAGVLEPQGMVGIKFRREKL LDTMNRLDDKYRELRSQLSNKSLAPEVHQQISKQLADRERELLPIYGQISLQFADLHDRS SRMVAKGVISKELEWTEARRFFFWRLRRRLNEEYLIKRLSHQVGEASRLEKIARIRSWYP ASVDHEDDRQVATWIEENYKTLDDKLKGLKLESFAQDLAKKIRSDHDNAIDGLSEVIKML STDDKEKLLKTLK
References
External Links
ResourceLink
Saccharomyces Genome Database FAS3
Uniprot IDQ00955
Uniprot NameACAC_YEAST
GenBank Gene IDZ71631
Genebank Protein ID1302498
PDB ID
1OD4
General Reference
  • Al-Feel, W., Chirala, S. S., Wakil, S. J. (1992). "Cloning of the yeast FAS3 gene and primary structure of yeast acetyl-CoA carboxylase." Proc Natl Acad Sci U S A 89:4534-4538.1350093
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Zhang, H., Yang, Z., Shen, Y., Tong, L. (2003). "Crystal structure of the carboxyltransferase domain of acetyl-coenzyme A carboxylase." Science 299:2064-2067.12663926
  • Shen, Y., Volrath, S. L., Weatherly, S. C., Elich, T. D., Tong, L. (2004). "A mechanism for the potent inhibition of eukaryotic acetyl-coenzyme A carboxylase by soraphen A, a macrocyclic polyketide natural product." Mol Cell 16:881-891.15610732
  • Zhang, H., Tweel, B., Tong, L. (2004). "Molecular basis for the inhibition of the carboxyltransferase domain of acetyl-coenzyme-A carboxylase by haloxyfop and diclofop." Proc Natl Acad Sci U S A 101:5910-5915.15079078