You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtein URA1
Synonyms
  • Glutamine-dependent carbamoyl-phosphate synthase
  • Aspartate carbamoyltransferase
Gene NameURA2
Enzyme Class
Biological Properties
General FunctionInvolved in carboxyl- or carbamoyltransferase activity
Specific FunctionThis protein is a "fusion" protein encoding three enzymatic activities of the pyrimidine pathway (GATase, CPSase, and ATCase)
Cellular LocationNot Available
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Pyrimidine metabolismec00240 Map00240
SMPDB Reactions
L-Aspartic acidN-Carbamoyl-L-aspartate
Hydrogen carbonate + water + L-Glutamine + Adenosine triphosphateADP + phosphate + L-Glutamic acid + hydron + Carbamoylphosphate
Hydrogen carbonate + water + L-Glutamine + Adenosine triphosphateADP + phosphate + L-Glutamic acid + hydron + Carbamoylphosphate
Carbamoylphosphate + L-Aspartic acidphosphate + hydron + N-Carbamoyl-L-aspartate
KEGG Reactions
L-Aspartic acid + CarbamoylphosphateUreidosuccinic acid + phosphate + hydron
Carbonic acid + Adenosine triphosphate + water + L-Glutaminephosphate + L-Glutamic acid + hydron + Carbamoylphosphate + ADP
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00027Ureidosuccinic acidShow
YMDB00082CarbamoylphosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB00382Carbonic acidShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00896L-Aspartic acidShow
YMDB00907phosphateShow
YMDB00914ADPShow
YMDB01008N-Carbamoyl-L-aspartateShow
YMDB16118Hydrogen carbonateShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
catalytic activity
adenyl ribonucleotide binding
transferase activity
ATP binding
ligase activity
carbamoyl-phosphate synthase activity
ligase activity, forming carbon-nitrogen bonds
aspartate carbamoyltransferase activity
carboxylic acid binding
amino acid binding
transferase activity, transferring one-carbon groups
carboxyl- or carbamoyltransferase activity
Process
cellular metabolic process
cellular aromatic compound metabolic process
cellular amino acid and derivative metabolic process
nucleobase metabolic process
cellular amino acid metabolic process
pyrimidine base metabolic process
glutamine family amino acid metabolic process
pyrimidine base biosynthetic process
glutamine metabolic process
'de novo' pyrimidine base biosynthetic process
metabolic process
nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL130C
Gene Sequence>6645 bp ATGGCCACTATTGCTCCCACTGCTCCAATCACCCCTCCAATGGAATCTACGGGTGACCGT CTGGTTACGTTGGAACTTAAGGACGGCACGGTCTTACAAGGTTATTCATTTGGTGCTGAG AAATCCGTCGCTGGTGAATTAGTTTTCCAAACTGGTATGGTTGGTTATCCTGAATCTGTG ACCGATCCATCTTATGAAGGCCAGATCTTAGTCATCACTTACCCATTGGTAGGCAATTAT GGTGTCCCAGATATGCACTTGAGAGATGAATTGGTCGAAGAATTGCCAAGATATTTTGAA AGTAATAGAATCCATATTGCCGGTTTAGTTATTTCTCACTATACCGACGAGTACTCTCAT TATCTTGCTAAATCTTCCTTAGGTAAATGGTTACAAAATGAAGGGATCCCAGCTGTTTAT GGTGTTGATACAAGATCATTGACCAAGCATTTGAGAGATGCAGGTTCAATGTTGGGTAGG TTGTCTTTGGAAAAAAGCGGCTCTGACAGAACCATCTCCAGATCTTCCTCTTGGAGAAGT GCGTTTGATGTTCCTGAATGGGTGGATCCAAATGTTCAAAACCTAGTTTCTAAGGTCTCC ATCAATGAACCTAAATTGTACGTTCCTCCAGCAGACAATAAGCACATCGAATTGCAAACC GGACCCGATGGTAAAGTTTTAAGGATTCTAGCCATTGACGTGGGTATGAAATACAATCAA ATTCGTTGTTTTATCAAAAGGGGTGTAGAATTGAAAGTTGTTCCATGGAACTACGATTTC ACTAAAGAAGATTATGATGGTCTGTTTATTTCAAATGGTCCAGGTGATCCATCTGTTCTA GATGATCTATCTCAAAGATTGTCAAATGTCCTGGAGGCTAAAAAGACGCCAGTATTCGGT ATTTGTCTCGGTCATCAATTGATAGCAAGAGCTGCCGGTGCATCCACCCTAAAACTAAAA TTTGGTAACCGTGGTCATAACATACCTTGTACATCAACTATAAGTGGTCGTTGTTACATA ACATCTCAAAACCATGGGTTCGCTGTGGATGTTGACACTCTAACTTCCGGATGGAAGCCA TTGTTTGTTAACGCGAATGATGACTCTAACGAAGGTATCTATCATTCTGAATTACCTTAT TTTTCCGTCCAATTCCATCCAGAATCCACACCTGGCCCAAGAGATACAGAATTCTTGTTT GACGTTTTTATCCAAGCAGTTAAAGAATTCAAGTATACACAAGTGTTGAAACCAATCGCT TTCCCAGGTGGCCTATTAGAGGATAACGTTAAGGCACACCCTAGAATCGAAGCGAAGAAG GTTCTAGTTCTCGGTTCTGGTGGTTTGTCCATCGGTCAAGCTGGTGAATTTGACTACTCT GGTTCTCAAGCCATCAAAGCTTTGAAAGAAGAAGGTATCTATACAATTTTAATTAATCCA AACATTGCTACCATCCAAACTTCGAAAGGGTTGGCTGATAAGGTTTATTTTGTTCCTGTT ACTGCAGAGTTCGTGAGAAAAGTTATTTTACATGAAAGGCCGGACGCCATTTATGTGACA TTTGGTGGACAAACTGCTTTATCTGTTGGTATAGCCATGAAAGATGAATTTGAGGCGTTA GGAGTTAAAGTATTGGGTACTCCAATCGATACTATTATTACCACGGAAGACCGTGAACTC TTCAGTAATGCCATTGACGAAATTAATGAAAAATGTGCGAAATCTCAAGCTGCTAATTCA GTGGACGAGGCATTGGCCGCTGTCAAGGAGATCGGTTTCCCAGTTATTGTACGTGCTGCA TATGCATTGGGAGGTTTAGGTTCCGGTTTCGCTAATAATGAAAAAGAATTGGTTGATCTA TGTAATGTTGCATTTTCATCCTCACCTCAAGTTTTAGTCGAGAAATCTATGAAAGGTTGG AAAGAAGTCGAATATGAAGTTGTTCGTGATGCTTTTGACAACTGTATTACTGTTTGTAAT ATGGAAAATTTTGATCCACTAGGTATTCACACCGGTGATTCCATCGTTGTAGCCCCATCT CAAACTTTATCTGATGAAGATTACAATATGTTAAGAACTACTGCTGTTAATGTTATTAGA CACTTAGGTGTTGTTGGTGAATGTAATATCCAATATGCTTTAAATCCCGTTTCTAAGGAT TATTGCATCATTGAAGTTAATGCGCGTTTGTCACGTTCCTCTGCTTTAGCTTCTAAGGCT ACTGGTTACCCATTGGCCTACACTGCGGCTAAGTTAGGTTTGAATATCCCATTAAATGAA GTTAAGAATTCCGTCACAAAATCCACATGTGCTTGTTTTGAACCTTCTCTAGACTACTGT GTTGTCAAAATGCCAAGATGGGATTTGAAGAAGTTCACCAGAGTTTCTACCGAATTATCT TCATCAATGAAATCTGTTGGTGAAGTTATGAGCATCGGTAGAACCTTCGAAGAAGCTATT CAAAAAGCTATCAGATCCACAGAATATGCTAACCTCGGATTCAATGAGACAGATCTAGAT ATCGACATTGATTACGAGTTGAACAACCCTACGGATATGCGTGTCTTCGCCATTGCAAAT GCTTTTGCTAAGAAGGGATATTCTGTTGATAAAGTCTGGGAAATGACTAGAATTGATAAG TGGTTTTTAAACAAACTGCACGATTTGGTCCAATTTGCTGAGAAAATTAGTTCATTTGGT ACTAAAGAGGAATTACCTTCCTTAGTTTTAAGACAGGCTAAGCAGTTAGGTTTTGATGAC AGACAGATTGCAAGATTTTTGGATTCCAACGAAGTTGCCATCCGTAGATTAAGAAAAGAA TATGGAATTACACCATTTGTCAAACAAATTGATACAGTTGCCGCTGAATTCCCCGCTTAC ACGAACTATTTATACATGACATACAATGCTGACTCACACGATTTATCCTTTGATGACCAC GGTGTTATGGTCTTGGGTTCTGGTGTTTACCGTATCGGTTCTTCTGTCGAATTTGATTGG TGTGCTGTTACTGCAGTTAGAACATTACGTGCCAACAATATCAAAACTATCATGGTCAAC TATAATCCAGAAACTGTTTCCACAGATTATGATGAGGCTGATAGACTATACTTTGAAACC ATCAACCTTGAAAGAGTTTTGGATATTTACGAGATTGAAAACTCAAGCGGTGTTGTCGTA TCAATGGGTGGTCAAACTTCCAACAACATCGCCATGACTTTACATCGTGAAAATGTAAAG ATTCTTGGTACATCCCCTGACATGATTGATTCTGCTGAAAACCGTTACAAGTTCTCTCGT ATGTTGGATCAAATTGGTGTTGACCAACCAGCTTGGAAAGAATTGACATCCATGGACGAA GCTGAATCTTTTGCCGAAAAGGTGGGTTATCCAGTTTTGGTACGTCCATCTTATGTGTTA TCCGGTGCCGCCATGAATACTGTTTATTCTAAAAACGATTTGGAATCCTACTTAAACCAA GCCGTCGAAGTTTCACGTGATTATCCTGTTGTTATCACTAAATATATTGAAAACGCAAAG GAGATTGAAATGGATGCAGTTGCAAGAAATGGTGAATTGGTTATGCATGTTGTCTCTGAG CATGTTGAAAATGCAGGTGTCCACTCGGGTGATGCAACATTAATCGTTCCACCTCAAGAT TTGGCTCCTGAAACTGTGGATAGAATTGTTGTCGCCACTGCTAAAATTGGTAAGGCTTTG AAAATTACAGGTCCATACAACATCCAATTCATTGCAAAGGACAATGAAATCAAGGTCATA GAATGTAATGTTCGTGCTTCGAGATCTTTCCCATTCATTTCAAAGGTTGTTGGCGTCAAT CTGATTGAATTGGCAACAAAGGCCATAATGGGTTTGCCTTTGACGCCTTATCCTGTTGAA AAATTACCAGATGATTATGTCGCCGTTAAAGTACCACAATTCTCTTTCCCACGTTTAGCA GGAGCTGATCCAGTCTTAGGTGTTGAAATGGCCTCTACTGGTGAAGTCGCTACTTTTGGC CACTCGAAGTATGAAGCATACTTAAAGTCTTTGTTGGCAACCGGCTTCAAACTTCCAAAG AAGAATATTTTATTGTCTATTGGTTCTTACAAGGAAAAACAAGAATTGCTTTCTTCCGTA CAAAAACTATACAACATGGGATATAAATTATTTGCAACATCAGGTACTGCTGACTTTTTA TCTGAACATGGTATTGCCGTCCAATATCTGGAGGTTTTAAACAAGGATGATGATGATCAA AAATCAGAATACTCACTTACTCAACATTTGGCTAATAATGAAATTGACCTTTACATCAAC TTGCCTTCTGCCAACAGGTTCCGTCGTCCTGCATCCTATGTTTCAAAGGGGTATAAAACA CGTCGTTTGGCTGTCGATTATTCGGTTCCGTTGGTTACTAACGTTAAATGTGCAAAATTG TTGATTGAAGCCATTTCAAGAAATATCACTTTAGATGTTTCTGAACGTGATGCACAAACT TCCCACAGAACTATTACCTTACCTGGTTTAATCAATATCGCAACTTATGTTCCGAATGCA TCCCATGTTATCAAAGGCCCAGCTGAACTGAAGGAGACCACACGTCTATTTTTGGAATCC GGTTTTACATACTGTCAATTGATGCCCAGATCCATCAGCGGACCTGTTATTACTGACGTT GCATCCTTGAAGGCCGCAAACTCTGTTTCCCAAGATTCATCTTACACTGACTTTTCTTTC ACTATTGCTGGTACAGCACACAATGCTCATAGTGTTACGCAATCTGCTAGCAAAGTGACA GCATTGTTTTTGCCCCTACGTGAATTAAAGAACAAGATCACAGCAGTAGCTGAACTTCTG AATCAGTGGCCAACTGAAAAGCAAGTGATTGCAGAAGCTAAAACTGCAGATTTGGCATCG GTTTTATTGTTAACCTCCCTTCAAAACAGATCTATTCACATTACTGGTGTTTCGAATAAG GAAGATTTAGCTTTGATCATGACGGTCAAGGCAAAAGACCCTAGAGTGACTTGTGATGTC AATATTTATTCTTTGTTTATTGCCCAAGATGACTATCCGGAGGCAGTTTTCTTGCCTACT AAGGAAGATCAAGAGTTTTTCTGGAACAACCTTGATAGTATCGATGCTTTCTCTGTCGGT GCTCTTCCTGTCGCCTTGGCAAATGTCACAGGTAACAAGGTTGATGTTGGTATGGGTATC AAAGATTCATTACCACTATTGTTGGCTGCTGTTGAAGAAGGTAAATTAACCATTGATGAT ATCGTCCTTCGTCTGCATGACAATCCCGCTAAAATTTTCAACATCCCTACTCAGGACTCA GTTGTCGAAATTGATTTGGATTATTCTTTCAGACGTAATAAGAGATGGTCACCATTCAAC AAAGATATGAACGGTGGTATTGAGCGTGTTGTCTATAATGGCGAAACATTAGTTTTGAGC GGTGAATTAGTTTCACCAGGCGCCAAAGGAAAATGCATTGTTAATCCAAGTCCAGCTTCC ATAACTGCTTCCGCAGAGCTCCAATCTACTAGTGCTAAAAGAAGGTTCTCGATCACGGAA GAAGCAATCGCTGATAATTTAGATGCCGCGGAGGATGCAATTCCAGAACAGCCTTTGGAA CAAAAATTGATGTCTTCAAGGCCACCAAGAGAACTTGTTGCTCCAGGCGCCATCCAGAAT TTGATCCGTAGTAACAATCCATTCCGCGGAAGACATATATTGTCTATCAAACAATTCAAA CGTTCTGATTTCCATGTGTTGTTTGCTGTTGCACAAGAACTAAGGGCACGTGTCGCAAGA GAAGGTGTCTTAGATTTAATGAAAGGCCACGTTATTACTACAATTTTCTTTGAACCATCT ACTCGTACTTGTTCTTCATTCATTGCTGCTATGGAACGTTTGGGTGGTAGAATTGTAAAT GTTAATCCATTGGTGTCTTCTGTCAAGAAAGGTGAAACCCTTCAAGATACTATCAGAACT TTGGCTTGTTACAGTGATGCCATTGTCATGCGTCATTCAGAAGAAATGTCTGTTCATATC GCCGCTAAATATTCTCCTGTTCCAATTATTAATGGTGGTAATGGTTCTCGCGAGCATCCT ACGCAGGCCTTCTTGGATTTGTTTACGATTCGTGAAGAAATCGGTACTGTTAATGGTATT ACTGTTACTTTCATGGGTGATCTCAAACATGGTAGAACCGTACATTCATTGTGTCGTTTG TTAATGCACTATCAAGTCAGAATTAATCTTGTTTCTCCTCCGGAATTGAGGTTACCAGAA GGATTAAGAGAAGAGCTAAGAAAAGCTGGCTTACTTGGTGTTGAGAGCATTGAATTAACC CCTCATATCATCTCAAAGACCGATGTTCTGTATTGTACAAGGGTCCAAGAAGAAAGATTC AATAGCCCTGAAGAATATGCACGTCTGAAGGATACTTATATCGTGGACAACAAGATCTTG GCACACGCCAAAGAAAATATGGCTATCATGCATCCATTGCCTCGTGTAAATGAAATCAAA GAGGAAGTGGACTACGATCATCGTGCTGCTTACTTCAGACAAATGAAGTATGGTTTGTTC GTCAGAATGGCTTTGTTGGCCATGGTCATGGGTGTTGATATGTGA
Protein Properties
Pfam Domain Function
Protein Residues2214
Protein Molecular Weight245124.0
Protein Theoretical pI5.64
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Protein URA1 MATIAPTAPITPPMESTGDRLVTLELKDGTVLQGYSFGAEKSVAGELVFQTGMVGYPESV TDPSYEGQILVITYPLVGNYGVPDMHLRDELVEELPRYFESNRIHIAGLVISHYTDEYSH YLRKSSLGKWLQNEGIPAVYGVDTRSLTKHLRDAGSMLGRLSLEKSGSDRTISRSSSWRS AFDVPEWVDPNVQNLVSKVSINEPKLYVPPADNKHIELQTGPDGKVLRILAIDVGMKYNQ IRCFIKRGVELKVVPWNYDFTKEDYDGLFISNGPGDPSVLDDLSQRLSNVLEAKKTPVFG ICLGHQLIARAAGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHGFAVDVDTLTSGWKP LFVNANDDSNEGIYHSELPYFSVQFHPESTPGPRDTEFLFDVFIQAVKEFKYTQVLKPIA FPGGLLEDNVKAHPRIEAKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINP NIATIQTSKGLADKVYFVPVTAEFVRKVILHERPDAIYVTFGGQTALSVGIAMKDEFEAL GVKVLGTPIDTIITTEDRELFSNAIDEINEKCAKSQAANSVDEALAAVKEIGFPVIVRAA YALGGLGSGFANNEKELVDLCNVAFSSSPQVLVEKSMKGWKEVEYEVVRDAFDNCITVCN MENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKD YCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEVKNSVTKSTCACFEPSLDYC VVKMPRWDLKKFTRVSTELSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYANLGFNETDLD IDIDYELNNPTDMRVFAIANAFAKKGYSVDKVWEMTRIDKWFLNKLHDLVQFAEKISSFG TKEELPSLVLRQAKQLGFDDRQIARFLDSNEVAIRRLRKEYGITPFVKQIDTVAAEFPAY TNYLYMTYNADSHDLSFDDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANNIKTIMVN YNPETVSTDYDEADRLYFETINLERVLDIYEIENSSGVVVSMGGQTSNNIAMTLHRENVK ILGTSPDMIDSAENRYKFSRMLDQIGVDQPAWKELTSMDEAESFAEKVGYPVLVRPSYVL SGAAMNTVYSKNDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVARNGELVMHVVSE HVENAGVHSGDATLIVPPQDLAPETVDRIVVATAKIGKALKITGPYNIQFIAKDNEIKVI ECNVRASRSFPFISKVVGVNLIELATKAIMGLPLTPYPVEKLPDDYVAVKVPQFSFPRLA GADPVLGVEMASTGEVATFGHSKYEAYLKSLLATGFKLPKKNILLSIGSYKEKQELLSSV QKLYNMGYKLFATSGTADFLSEHGIAVQYLEVLNKDDDDQKSEYSLTQHLANNEIDLYIN LPSANRFRRPASYVSKGYKTRRLAVDYSVPLVTNVKCAKLLIEAISRNITLDVSERDAQT SHRTITLPGLINIATYVPNASHVIKGPAELKETTRLFLESGFTYCQLMPRSISGPVITDV ASLKAANSVSQDSSYTDFSFTIAGTAHNAHSVTQSASKVTALFLPLRELKNKITAVAELL NQWPTEKQVIAEAKTADLASVLLLTSLQNRSIHITGVSNKEDLALIMTVKAKDPRVTCDV NIYSLFIAQDDYPEAVFLPTKEDQEFFWNNLDSIDAFSVGALPVALANVTGNKVDVGMGI KDSLPLLLAAVEEGKLTIDDIVLRLHDNPAKIFNIPTQDSVVEIDLDYSFRRNKRWSPFN KDMNGGIERVVYNGETLVLSGELVSPGAKGKCIVNPSPASITASAELQSTSAKRRFSITE EAIADNLDAAEDAIPEQPLEQKLMSSRPPRELVAPGAIQNLIRSNNPFRGRHILSIKQFK RSDFHVLFAVAQELRAAVAREGVLDLMKGHVITTIFFEPSTRTCSSFIAAMERLGGRIVN VNPLVSSVKKGETLQDTIRTLACYSDAIVMRHSEEMSVHIAAKYSPVPIINGGNGSREHP TQAFLDLFTIREEIGTVNGITVTFMGDLKHGRTVHSLCRLLMHYQVRINLVSPPELRLPE GLREELRKAGLLGVESIELTPHIISKTDVLYCTRVQEERFNSPEEYARLKDTYIVDNKIL AHAKENMAIMHPLPRVNEIKEEVDYDHRAAYFRQMKYGLFVRMALLAMVMGVDM
References
External Links
ResourceLink
Saccharomyces Genome Database URA2
Uniprot IDP07259
Uniprot NamePYR1_YEAST
GenBank Gene IDM27174
Genebank Protein ID173146
General Reference
  • Souciet, J. L., Nagy, M., Le Gouar, M., Lacroute, F., Potier, S. (1989). "Organization of the yeast URA2 gene: identification of a defective dihydroorotase-like domain in the multifunctional carbamoylphosphate synthetase-aspartate transcarbamylase complex." Gene 79:59-70.2570735
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Souciet, J. L., Potier, S., Hubert, J. C., Lacroute, F. (1987). "Nucleotide sequence of the pyrimidine specific carbamoyl phosphate synthetase, a part of the yeast multifunctional protein encoded by the URA2 gene." Mol Gen Genet 207:314-319.3039294
  • Cziepluch, C., Kordes, E., Pujol, A., Jauniaux, J. C. (1996). "Sequencing analysis of a 40.2 kb fragment of yeast chromosome X reveals 19 open reading frames including URA2 (5' end), TRK1, PBS2, SPT10, GCD14, RPE1, PHO86, NCA3, ASF1, CCT7, GZF3, two tRNA genes, three remnant delta elements and a Ty4 transposon." Yeast 12:1471-1474.8948101
  • Juneau, K., Palm, C., Miranda, M., Davis, R. W. (2007). "High-density yeast-tiling array reveals previously undiscovered introns and extensive regulation of meiotic splicing." Proc Natl Acad Sci U S A 104:1522-1527.17244705
  • Zhang, Z., Hesselberth, J. R., Fields, S. (2007). "Genome-wide identification of spliced introns using a tiling microarray." Genome Res 17:503-509.17351133
  • Katsoulou, C., Tzermia, M., Tavernarakis, N., Alexandraki, D. (1996). "Sequence analysis of a 40.7 kb segment from the left arm of yeast chromosome X reveals 14 known genes and 13 new open reading frames including homologues of genes clustered on the right arm of chromosome XI." Yeast 12:787-797.8813765
  • Akada, R., Yamamoto, J., Yamashita, I. (1997). "Screening and identification of yeast sequences that cause growth inhibition when overexpressed." Mol Gen Genet 254:267-274.9150260
  • Nagy, M., Le Gouar, M., Potier, S., Souciet, J. L., Herve, G. (1989). "The primary structure of the aspartate transcarbamylase region of the URA2 gene product in Saccharomyces cerevisiae. Features involved in activity and nuclear localization." J Biol Chem 264:8366-8374.2498313
  • Denis-Duphil, M., Lecaer, J. P., Hardie, D. G., Carrey, E. A. (1990). "Yeast carbamoyl-phosphate-synthetase--aspartate-transcarbamylase multidomain protein is phosphorylated in vitro by cAMP-dependent protein kinase." Eur J Biochem 193:581-587.1977585
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956