You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameArginyl-tRNA synthetase, mitochondrial
Synonyms
  • Arginine--tRNA ligase
  • ArgRS
Gene NameMSR1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-arginine + tRNA(Arg) = AMP + diphosphate + L-arginyl-tRNA(Arg)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Arginine + Adenosine triphosphate + tRNA(Arg) → Adenosine monophosphate + Pyrophosphate + Arg-tRNA(Arg)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00592L-ArginineShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
arginine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
Process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
arginyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR091C
Gene Sequence>1932 bp ATGTTCGGGATAGTTTATCTGAAGAATCGCAGTTTACTCTGCAAGAACCCCTTTTCTTCT TACCCTCGTTATGGCTTCATGCCCTCGTTCGACACCCAGTTCAGCAACCAATTTCGTAAA TTAGAAATTAATATTGGACGGAAAAGATACAGCTCAAAAACCTTGAATACAAAATATACT GACCAACCCGAAGGCCCAATTTATCCTTTGGATGTACTACGCCTAGACATCTCAAAAGCA CTGCATGATATATCCGGAATAGACCACTCGCTAATACTAAATGCGCTTGAGTCGACAAAT AGTATGGATAGAGGTGATCTACTGCTACCTCTTCCAAAGATAAAAGTGGCTGACCCTGTG GCCGTTGCCAACCGATGGGCCATTGAACTAAGCACGCATGGGTGTATTGGAAAGGTTTGT GCAAAAGGGCCATTTCTTCAGTTCTTCCTGGACCAGCGGTATTTGATACAATCAACGGTA CCAAATATATTACTTCAAAAGGGGAAATATGGTCAGAAAAAATCTCGTCATCAGAAAAAA GTTGTAGTAGAATTTTCATCACCAAATATTGCCAAACCATTCCATGCAGGCCATTTAAGA TCGACTATAATAGGTGGATTCCTTTCAAACTTATATGAAGCAATGGGGTGGTCCGTTACA CGTATGAACTACCTAGGAGACTGGGGCAGACAGTTTGGTTTGTTAGCAGTCGGTTTTAAG AGATACGGCGATGAAAAGACGTTACAAAAGCAGCCAATTCAGCATTTATTCGACGTCTAC GTTAAAATCAACATGGACCTTGCCAAGGAAGAGATAAACGGAAACTCTAAGTGTGGGATT AGCGGTGAGGCCCGTAGTTTTTTCAAAAACTTAGAAAATGGGGATGAGAATGCCATTAAG ATATGGAATAGGTTTCGCTCGTTATCCATCCACCACTATATCCAAACTTATTCACGTTTG AACATTAATTTTGATATATTCTCCGGTGAATCACAAGTGTCTAAAGAATCTATGAATGAA GCCTTAGATATATTTCGCAAAAACAATCTTGTTAAAGAAATAGACGGTGCCCTTGTCATC GATTTAACCCAATGGTCGAAAAGATTGGGCAGAGTTGTTGTACAAAAATCAGACGGAACA ACTTTGTACTTGACAAGAGATGTAGGGGCAGCCATAGAGCGTAAAAAGAATCTACATTTT GATAAAATGGTGTACGTGATTTCCTCACAGCAAGATTTATACATGTCCCAGTTTTTTATG ATATTAAAAAAAATGAATTTTGAATGGGCAAAAGACTTGCAGCATATAAATTTTGGTATG GTGCAGGGCATGTCGACCAGAAAAGGAAATGTGGTATTCTTAGATACCATACTAGACGAG GCAAGGGATAAAGCTCTGCAAATTATGGAAAATAACAAAATGAAAATATCTCAGGTAGAT AATCCACAGCGTGTTGCAGATTTAATTGGCGTATCTGCTATCATTATTCAAGATACGAAA TCAAAGCGTATCAATAACTATGAATTCAACTGGAACAGAATGTTGTCTTTCGAAGGTGAC ACAGGGCCCTATTTACAATACACACATTCCAGACTTAGATCTTTAGAAAGGACCTCCAGC GACTTTACGACGGACATGCTAATACACGCAGATTTTTCAAATTTAAATGAACCACAACTA GTTGAGCTTGTGAGGTTGCTAGCGCAGTATCCAGATGTCCTTAGACGAGCATTCGAAACT CAAGAGCCGGCCACGATTGTAACATATTTATTCAAAGTTTGCCATCAGGTCTCCTCGTGC TATAAAAAAATATGGGTTTCCGGAAAACCTGCAGATATTGCCATACCGCGACTCGCCGTA TATTCAGCAAGTAGACAAGTGTTACACAATGCAATGTCGCTTTTGGGACTAGTCCCGGTT GATAGAATGTAA
Protein Properties
Pfam Domain Function
Protein Residues643
Protein Molecular Weight73693.39844
Protein Theoretical pI9.84
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Arginyl-tRNA synthetase, mitochondrial MFGIVYLKNRSLLCKNPFSSYPRYGFMPSFDTQFSNQFRKLEINIGRKRYSSKTLNTKYT DQPEGPIYPLDVLRLDISKALHDISGIDHSLILNALESTNSMDRGDLLLPLPKIKVADPV AVANRWAIELSTHGCIGKVCAKGPFLQFFLDQRYLIQSTVPNILLQKGKYGQKKSRHQKK VVVEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEAMGWSVTRMNYLGDWGRQFGLLAVGFK RYGDEKTLQKQPIQHLFDVYVKINMDLAKEEINGNSKCGISGEARSFFKNLENGDENAIK IWNRFRSLSIHHYIQTYSRLNINFDIFSGESQVSKESMNEALDIFRKNNLVKEIDGALVI DLTQWSKRLGRVVVQKSDGTTLYLTRDVGAAIERKKNLHFDKMVYVISSQQDLYMSQFFM ILKKMNFEWAKDLQHINFGMVQGMSTRKGNVVFLDTILDEARDKALQIMENNKMKISQVD NPQRVADLIGVSAIIIQDMKSKRINNYEFNWNRMLSFEGDTGPYLQYTHSRLRSLERTSS DFTTDMLIHADFSNLNEPQLVELVRLLAQYPDVLRRAFETQEPATIVTYLFKVCHQVSSC YKKIWVSGKPADIAIPRLAVYSASRQVLHNAMSLLGLVPVDRM
References
External Links
ResourceLink
Saccharomyces Genome Database MSR1
Uniprot IDP38714
Uniprot NameSYRM_YEAST
GenBank Gene IDL39019
Genebank Protein ID633022
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229