You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAsparaginyl-tRNA synthetase, mitochondrial
Synonyms
  • Asparagine--tRNA ligase
  • AsnRS
Gene NameSLM5
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-asparagine + tRNA(Asn) = AMP + diphosphate + L-asparaginyl-tRNA(Asn)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Asparagine + tRNA(Asn) → Adenosine monophosphate + Pyrophosphate + Asn-tRNA(Asn)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00226L-AsparagineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
purine nucleoside binding
adenyl nucleotide binding
nucleic acid binding
adenyl ribonucleotide binding
aspartate-tRNA ligase activity
ATP binding
asparagine-tRNA ligase activity
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
nucleoside binding
Process
translation
aspartyl-tRNA aminoacylation
asparaginyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCR024C
Gene Sequence>1479 bp ATGTTTCATGCTTTCACCTTCCTTAAAGGTGGTAGATTTTACTCTTCACTAACAGTTAAA TCATTGTACGAGCAGGTACACCATACTAGCCATGATCCCATTTCAATTAATGGATGGATC AAATCCATAAGACTATTAAAACGTATAGCGTTTTTGGATTTACAAGATGGGACTTCTGTG AACCCATTAAGAATAGTTATTCCACTCACAAATACTGATGAAGTACAGTTCCTAAAAATT CTGAAAACTGGTCAAACTTTATCTATATCTAATGCTACCTGGCAAAGCACCCCTAATAGA AAACAACCTTTTGAATTGCAAATCAAAAATCCTGTCAAGTCAATTAAACTTGTGGGTCCC GTTTCAGAAAACTATCCATTACAAAAGAAATATCAAACCTTACGTTATTTAAGGTCCTTA CCTACACTAAAATACAGAACCGCTTACTTAAGTGCAATTTTACGGTTAAGATCCTTTGTA GAATTCCAGTTCATGCTATATTTCCAGAAAAACCACTTCACCAAAGTTTCACCACCAATA TTAACTTCAAACGATTGTGAAGGTGCCGGCGAGTTGTTTCAAGTCTCCACCAATACGTCG CCAACTGCATCCTCGTACTTTGGGAAGCCGACTTATTTGACTGTGTCCACTCAATTGCAC TTGGAAATTTTAGCGTTATCACTGTCAAGGTGTTGGACGTTATCTCCTTGCTTTAGAGCC GAAAAGAGTGATACTCCAAGACACCTTTCGGAGTTTTGGATGCTTGAAGTGGAAATGTGC TTTGTTAATAGCGTCAACGAGCTAACATCGTTTGTTGAGACTACAATAAAACACATAATT AAAGCTTGTATAGATAACCAACAAGAACTCTTGCCGAAGCAATTTATCTCTTCACAAGAA AATAATGCATCGTCAGAGCTATCAATAAATCAAGAGACACAACAAATTAAAACACGATGG GAAGATTTAATAAATGAAAAATGGCACAATATAACGTATACCAATGCAATAGAAATTCTC AAGAAACGCCACAATGAAGTTTCACACTTTAAGTATGAACCTAAATGGGGACAGCCTTTG CAAACTGAACATGAAAAATTTTTAGCCGGAGAGTATTTTAAGTCCCCAGTTTTCGTTACC GACTATCCACGTCTTTGTAAACCATTCTACATGAAACAAAATTCCACTCCTGACGATACT GTTGGATGCTTTGATCTACTGGTTCCTGGAATGGGTGAAATAATTGGTGGGAGTTTAAGG GAAGATGACTATGACAAGTTATGTAGAGAAATGAAAGCACGCGGGATGAATAGATCTGGA GAATTGGACTGGTATGTTTCTCTGAGAAAAGAAGGAAGTGCACCACACGGAGGCTTTGGT CTAGGGTTTGAGAGATTTATCTCATACTTATATGGCAACCATAATATAAAGGATGCCATA CCCTTTTATAGAACATCTGCAGAATCCATCGATTTTTGA
Protein Properties
Pfam Domain Function
Protein Residues492
Protein Molecular Weight56784.39844
Protein Theoretical pI8.64
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Asparaginyl-tRNA synthetase, mitochondrial MFHAFTFLKGGRFYSSLTVKSLYEQVHHTSHDPISINGWIKSIRLLKRIAFLDLQDGTSV NPLRIVIPLTNTDEVQFLKILKTGQTLSISNATWQSTPNRKQPFELQIKNPVKSIKLVGP VSENYPLQKKYQTLRYLRSLPTLKYRTAYLSAILRLRSFVEFQFMLYFQKNHFTKVSPPI LTSNDCEGAGELFQVSTNTSPTASSYFGKPTYLTVSTQLHLEILALSLSRCWTLSPCFRA EKSDTPRHLSEFWMLEVEMCFVNSVNELTSFVETTIKHIIKACIDNQQELLPKQFISSQE NNASSELSINQETQQIKTRWEDLINEKWHNITYTNAIEILKKRHNEVSHFKYEPKWGQPL QTEHEKFLAGEYFKSPVFVTDYPRLCKPFYMKQNSTPDDTVGCFDLLVPGMGEIIGGSLR EDDYDKLCREMKARGMNRSGELDWYVSLRKEGSAPHGGFGLGFERFISYLYGNHNIKDAI PFYRTSAESIDF
References
External Links
ResourceLink
Saccharomyces Genome Database SLM5
Uniprot IDP25345
Uniprot NameSYNM_YEAST
GenBank Gene IDX59720
Genebank Protein ID1907168
General Reference
  • Bolle, P. A., Gilliquet, V., Berben, G., Dumont, J., Hilger, F. (1992). "The complete sequence of K3B, a 7.9 kb fragment between PGK1 and CRY1 on chromosome III, reveals the presence of seven open reading frames." Yeast 8:205-213.1574926
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Landrieu, I., Vandenbol, M., Hartlein, M., Portetelle, D. (1997). "Mitochondrial asparaginyl-tRNA synthetase is encoded by the yeast nuclear gene YCR24c." Eur J Biochem 243:268-273.9030748
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106