You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutamine-dependent NAD(+) synthetase
Synonyms
  • NAD(+) synthase [glutamine-hydrolyzing]
Gene NameQNS1
Enzyme Class
Biological Properties
General FunctionInvolved in NAD+ synthase (glutamine-hydrolyzing) activity
Specific FunctionATP + deamido-NAD(+) + L-glutamine + H(2)O = AMP + diphosphate + NAD(+) + L-glutamate
Cellular LocationCytoplasmic
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB Reactions
Adenosine triphosphate + deamido-NAD(+) + water + L-GlutamineNAD + hydron + Adenosine monophosphate + Pyrophosphate + L-Glutamic acid
KEGG Reactions
Adenosine triphosphate + Ammonium + deamido-NAD(+)Adenosine monophosphate + Pyrophosphate + NAD + hydron
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00110NADShow
YMDB00219PyrophosphateShow
YMDB00271L-Glutamic acidShow
YMDB00306deamido-NAD(+)Show
YMDB00412NAD(+)Show
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
catalytic activity
NAD+ synthase (glutamine-hydrolyzing) activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
carbon-nitrogen ligase activity, with glutamine as amido-N-donor
binding
nucleoside binding
purine nucleoside binding
Process
metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
pyridine nucleotide biosynthetic process
nitrogen compound metabolic process
nicotinamide nucleotide biosynthetic process
NAD biosynthetic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR074W
Gene Sequence>2145 bp ATGTCACATCTTATCACTTTAGCTACATGCAACTTGAATCAATGGGCCCTAGATTTTGAA GGTAATAGAGACCGTATCCTACAGTCCATTAAGATTGCCAAAGAGAGGGGTGCCAGGTTA CGTGTCGGCCCAGAACTGGAAATAACTGGCTACGGATGTTTAGATCATTTTTTAGAAAAT GACGTTTGCCTTCATTCATGGGAAATGTATGCTCAAATCATTAAGAATAAAGAAACCCAT GGATTAATACTTGACATTGGTATGCCCGTTCTACACAAGAATGTTCGTTATAATTGTCGT TTGTTATCCTTGGATGGTGAGATATTGTTCATAAGACCTAAGATTTGGTTAGCTAATGAT GGTAACTATAGGGAAATGAGATTTTTCACACCTTGGATGAAACCTGGCGTGGTGGAGGAC TTTATCCTTCCACCTGAGATTCAGAAAGTTACCGGCCAGAGACTTGTGCCATTTGGGGAC GCTGTGATAAATTCATTGGATACATGCATTGGTACAGAAACTTGTGAAGAATTGTTTACA CCTCAATCCCCCCACATCGCCATGTCTTTAGATGGTGTGGAAATCATGACAAACTCATCT GGTTCTCATCATGAACTGCGTAAGTTAAATAAAAGGTTAGACCTAATTTTAAATGCCACT AAACGTTGTGGTGGTGTTTACTTGTATGCAAATCAAAGAGGTTGTGATGGTGACAGATTA TATTATGATGGCTGTGCACTAATTGCCATCAATGGTACAATTGTAGCCCAAGGTTCACAA TTTTCGCTAGATGATGTGGAAGTAGTTACTGCTACTGTGGACCTAGAAGAGGTGAGGAGT TATCGTGCAGCTGTCATGTCTCGTGGCCTACAAGCCTCCTTGGCAGAAATAAAGTTCAAG CGTATTGATATTCCTGTAGAATTGGCTTTAATGACCTCCAGATTTGATCCTACAGTGTGT CCAACAAAAGTCCGCGAGCCTTTCTATCACTCTCCTGAGGAAGAAATTGCACTGGGACCT GCTTGCTGGATGTGGGATTATTTAAGACGTTGTAACGGAACAGGGTTTTTCCTTCCCTTA TCTGGGGGCATTGACTCTTGTGCAACTGCAATGATTGTCCACTCTATGTGCCGTTTAGTG ACCGACGCTGCTCAAAATGGAAATGAGCAAGTTATCAAAGACGTTCGTAAGATAACACGT AGCGGCGATGATTGGATTCCAGACAGTCCACAGGATCTAGCCTCAAAAATATTTCACTCC TGTTTCATGGGTACGGAAAATTCATCCAAGGAGACAAGAAACAGAGCAAAGGACCTTTCC AATGCAATTGGATCTTACCACGTGGATTTAAAGATGGACTCATTGGTATCCAGTGTGGTG TCCTTATTCGAAGTAGCCACTGGCAAAAAACCAATATACAAAATATTTGGGGGATCTCAA ATCGAGAACTTGGCTTTACAAAACATCCAGGCGCGTCTAAGAATGGTTCTTTCTTATCTT TTTGCGCAACTGTTGCCGTGGGTTCGTGGTATCCCAAACTCGGGTGGATTGTTAGTACTT GGTAGCGCAAATGTTGATGAGTGCTTACGTGGGTATCTAACAAAATATGACTGCTCCTCC GCAGATATCAACCCTATTGGGGGTATTTCAAAAACTGACTTGAAAAGATTCATTGCCTAC GCATCAAAACAATATAACATGCCAATCTTGAATGACTTTTTAAACGCTACACCAACTGCA GAATTAGAACCTATGACTAAAGATTACGTTCAATCGGATGAGATAGATATGGGGATGACG TATGAAGAATTGGGCGTGTTTGGTTACCTAAGAAAGGTTGAAAAATGTGGTCCTTATTCT ATGTTCTTAAAACTTCTTCATCAATGGTCCCCAAAGTTAACACCTCGTCAAATATCTGAA AAGGTGAAAAGATTTTTCTTCTTCTATGCCATCAACAGACACAAGCAAACTGTTTTAACT CCTAGTTATCATGCTGAACAGTATTCACCAGAAGACAACAGATTTGACTTACGTCCTTTC TTAATCAACCCAAGATTTCCATGGGCTTCAAGAAAAATTGATGAAGTTGTCGAGCAGTGT GAAGCACATAAAGGCTCAACGCTTGACATTATGTCTATTGATTAG
Protein Properties
Pfam Domain Function
Protein Residues714
Protein Molecular Weight80684.89844
Protein Theoretical pI6.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutamine-dependent NAD(+) synthetase MSHLITLATCNLNQWALDFEGNRDRILQSIKIAKERGARLRVGPELEITGYGCLDHFLEN DVCLHSWEMYAQIIKNKETHGLILDIGMPVLHKNVRYNCRLLSLDGEILFIRPKIWLAND GNYREMRFFTPWMKPGVVEDFILPPEIQKVTGQRLVPFGDAVINSLDTCIGTETCEELFT PQSPHIAMSLDGVEIMTNSSGSHHELRKLNKRLDLILNATKRCGGVYLYANQRGCDGDRL YYDGCALIAINGTIVAQGSQFSLDDVEVVTATVDLEEVRSYRAAVMSRGLQASLAEIKFK RIDIPVELALMTSRFDPTVCPTKVREPFYHSPEEEIALGPACWMWDYLRRCNGTGFFLPL SGGIDSCATAMIVHSMCRLVTDAAQNGNEQVIKDVRKITRSGDDWIPDSPQDLASKIFHS CFMGTENSSKETRNRAKDLSNAIGSYHVDLKMDSLVSSVVSLFEVATGKKPIYKIFGGSQ IENLALQNIQARLRMVLSYLFAQLLPWVRGIPNSGGLLVLGSANVDECLRGYLTKYDCSS ADINPIGGISKTDLKRFIAYASKQYNMPILNDFLNATPTAELEPMTKDYVQSDEIDMGMT YEELGVFGYLRKVEKCGPYSMFLKLLHQWSPKLTPRQISEKVKRFFFFYAINRHKQTVLT PSYHAEQYSPEDNRFDLRPFLINPRFPWASRKIDEVVEQCEAHKGSTLDIMSID
References
External Links
ResourceLink
Saccharomyces Genome Database QNS1
Uniprot IDP38795
Uniprot NameNADE_YEAST
GenBank Gene IDU10556
Genebank Protein ID500832
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106