You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUrea amidolyase
Synonyms
  • Urea carboxylase
  • Allophanate hydrolase
Gene NameDUR1
Enzyme Class
Biological Properties
General FunctionInvolved in carbon-nitrogen ligase activity, with glutamine as amido-N-donor
Specific FunctionHydrolysis of urea to ammonia and CO(2)
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB ReactionsNot Available
KEGG Reactions
water + hydron + urea-1-carboxylic acidCarbon dioxide + Ammonium
Carbonic acid + Adenosine triphosphate + Ureaphosphate + hydron + ADP + urea-1-carboxylic acid
Metabolites
YMDB IDNameView
YMDB00003UreaShow
YMDB00091AmmoniaShow
YMDB00109Adenosine triphosphateShow
YMDB00124urea-1-carboxylic acidShow
YMDB00382Carbonic acidShow
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00912Carbon dioxideShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
catalytic activity
ATP binding
vitamin binding
ligase activity
biotin binding
ligase activity, forming carbon-nitrogen bonds
carbon-nitrogen ligase activity, with glutamine as amido-N-donor
Process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYBR208C
Gene Sequence>5508 bp ATGACAGTTAGTTCCGATACAACTGCTGAAATATCGTTAGGTTGGTCAATCCAAGACTGG ATTGATTTCCACAAGTCATCAAGCTCCCAGGCTTCACTAAGGCTTCTTGAATCACTACTA GACTCTCAAAATGTTGCGCCAGTCGATAATGCGTGGATATCGCTAATTTCAAAGGAAAAT TTACTGCACCAATTCCAAATTTTAAAGAGCAGAGAAAATAAAGAAACTCTACCTCTCTAC GGTGTCCCTATTGCTGTTAAGGACAACATCGACGTTAGAGGTCTACGCACCACCGCTGCA TGTCCATCCTTTGCATATGAGCCTTCCAAAGACTCTAAAGTAGTAGAACTACTAAGAAAT GCAGGTGCAATAATCGTGGGTAAGACAAACTTGGACCAATTTGCCACAGGATTAGTCGGC ACACGGTCTCCATATGGGAAAACACCTTGCGCTTTTAGCAAAGAGCATGTATCTGGTGGT TCCTCCGCTGGGTCAGCATCGGTGGTCGCCAGAGGTATCGTACCAATTGCATTGGGTACT GATACAGCAGGTTCTGGTAGAGTCCCAGCCGCCTTGAACAACCTGATTGGCCTAAAGCCA ACAAAGGGCGTCTTTTCCTGTCAAGGTGTAGTTCCCGCTTGTAAATCTTTAGACTGCGTC TCCATCTTTGCATTAAACCTAAGTGATGCTGAACGCTGCTTCCGCATCATGTGCCAGCCA GATCCTGATAATGATGAATATTCTAGACCCTATGTTTCCAACCCAAAGAAAAATTTTTCA AGCAATGTAACGATTGCTATTCCTAAAAATATCCCATGGTATGGTGAAACCAAGAATCCT GTACTGTTTTCCAATGCTGTCGAAAATCTATCAAGAACGGGCGCTAACGTCATAGAAATT GATTTTGAGCCTCTTTTAGAGTTAGCTCGCTGTTTATACGAAGGTACTTGGGTGGCCGAG CGTTATCAAGCTATTCAATCGTTTTTGGACAGTAAACCACCAAAGGAATCTTTGGACCCT ACTGTTATTTCAATTATAGAAGGGGCCAAGAAATACAGTGCAGTAGACTGCTTCAGTTTT GAATACAAAAGACAAGGCATCTTGCAAAAAGTGAGACGACTTCTCGAATCAGTCGATGTC TTGTGTGTGCCCACATGTCCCTTAAATCCTACTATGCAACAAGTTGCGGATGAACCAGTC CTAGTCAATTCAAGACAAGGCACATGGACTAATTTTGTCAACTTGGCAGATTTGGCAGCC CTTGCTGTTCCCGCAGGGTTCCGAGACGATGGTTTGCCAAATGGTATTACTTTAATCGGT AAAAAATTCACAGATTACGCACTATTAGAGTTGGCTAACCGCTATTTCCAAAATATGTTC CCCAACGGTTCCAGAACATACGGTACTTTTACCTCTTCTTCAGTAAAGCCAGCAAACGAT CAATTAGTGGGACCAGACTATGACCCATCTACGTCCATAAAATTGGCTGTTGTCGGTGCA CATCTTAAGGGTCTGCCTCTACATTGGCAATTGGAAAAGGTCAATGCAACATATTTATGT ACAACAAAAACATCAAAAGCTTACCAGCTTTTTGCTTTGCCCAAAAATGGACCAGTTTTA AAACCTGGTTTGAGAAGAGTTCAAGATAGCAATGGCTCTCAAATCGAATTAGAAGTGTAC AGTGTTCCAAAAGAACTGTTCGGTGCTTTTATTTCCATGGTTCCTGAACCATTGGGAATA GGTTCAGTGGAGTTAGAATCTGGTGAATGGATCAAATCCTTTATTTGTGAAGAATCTGGT TACAAAGCCAAAGGTACAGTTGATATCACAAAGTATGGTGGATTTAGAGCATATTTTGAA ATGTTGAAGAAAAAAGAGTCCCAAAAGAAGAAGTTATTTGATACCGTGTTAATTGCCAAT AGAGGTGAAATTGCCGTTCGTATTATCAAGACATTAAAAAAATTGGGTATTAGATCAGTT GCAGTTTATTCCGACCCTGATAAATATTCTCAACACGTTACTGATGCAGATGTTTCTGTA CCCCTTCATGGCACAACCGCAGCCCAAACTTATTTAGACATGAATAAGATCATAGATGCC GCTAAGCAAACTAATGCACAGGCCATTATTCCTGGTTATGGTTTCTTGTCGGAAAATGCG GATTTTTCTGATGCGTGCACCAGTGCTGGCATTACCTTTGTTGGTCCTTCGGGAGATATT ATCAGAGGTTTAGGGTTAAAACATTCTGCTAGACAGATTGCACAGAAGGCTGGCGTTCCT CTAGTGCCAGGCTCTTTGCTTATCACATCAGTTGAAGAGGCTAAGAAAGTCGCAGCGGAA TTGGAATACCCAGTTATGGTGAAGTCAACTGCTGGTGGCGGTGGTATTGGTTTGCAGAAA GTCGATTCTGAAGAGGACATCGAGCATATTTTTGAGACTGTGAAACATCAAGGTGAAACA TTTTTCGGTGACGCTGGTGTATTTCTGAAACGGTTTATCGAAAATGCCAGGCATGTTGAA GTCCAACTTATGGGAGATGGTTTTGGTAAGGCCATTGCTTTGGGCGAACGTGATTGTTCT TTACAGCGTCGTAACCAAAAAGTTATCGAAGAAACTCCTGCACCAAATTTGCCAGAAAAG ACGAGGTTGGCGTTAAGAAAGGCAGCTGAAAGTTTGGGATCTTTATTGAATTACAAGTGT GCTGGTACGGTTGAATTTATTTACGATGAGAAAAAGGACGAGTTTTACTTTTTAGAAGTT AATACAAGATTACAAGTTGAACATCCAATAACAGAAATGGTTACAGGGTTAGACTTGGTC GAGTGGATGATCAGGATTGCCGCTAATGATGCACCTGATTTTGATTCTACAAAGGTAGAA GTCAATGGGGTTTCAATGGAGGCACGTTTATATGCTGAAAATCCATTGAAAAATTTCAGA CCTTCTCCAGGTTTACTTGTCGATGTGAAATTTCCTGATTGGGCAAGAGTGGATACTTGG GTTAAGAAAGGTACTAATATTTCTCCCGAATATGATCCAACATTGGCCAAAATTATCGTT CATGGGAAAGACCGTGATGATGCAATTTCCAAGTTAAATCAAGCGTTAGAAGAAACAAAA GTTTACGGATGTATTACTAACATTGACTACCTGAAGTCTATCATTACCAGTGATTTCTTT GCTAAAGCAAAAGTTTCTACAAACATTTTGAACTCTTATCAATATGAGCCTACCGCCATC GAAATTACTTTGCCCGGTGCACACACTAGTATTCAGGATTACCCCGGTAGAGTTGGGTAC TGGAGAATTGGTGTTCCGCCCTCTGGTCCAATGGACGCATATTCGTTTAGATTGGCGAAC AGAATTGTTGGTAATGACTACAGGACTCCTGCCATTGAAGTAACGTTGACTGGTCCATCC ATCGTTTTCCATTGTGAAACTGTCATTGCCATTACTGGTGGTACCGCTCTATGTACATTA GACGGCCAAGAAATTCCCCAACACAAACCGGTCGAAGTTAAGAGGGGATCTACTTTATCC ATTGGCAAGTTGACAAGCGGCTGTAGAGCATACTTAGGTATCAGGGGTGGCATTGATGTG CCTAAATACTTGGGCTCTTATTCTACTTTCACTCTAGGAAATGTCGGTGGATACAATGGA AGGGTGCTAAAACTTGGAGACGTACTATTCTTACCAAGCAATGAAGAAAATAAATCAGTT GAGTGCCTTCCACAGAATATTCCTCAATCATTAATTCCTCAAATTTCCGAAACTAAGGAA TGGAGAATTGGTGTAACATGTGGTCCCCATGGGTCTCCAGATTTTTTTAAACCTGAGTCC ATCGAAGAATTTTTCAGTGAGAAGTGGAAGGTTCATTACAACTCCAATAGATTTGGTGTC CGTTTGATTGGACCTAAACCTAAGTGGGCAAGAAGTAATGGTGGTGAAGGTGGTATGCAT CCTTCAAACACTCACGATTACGTTTATTCTCTGGGTGCAATTAATTTCACGGGTGATGAG CCAGTTATTATTACTTGCGATGGTCCTTCCTTAGGTGGTTTTGTGTGTCAAGCTGTTGTC CCAGAAGCAGAACTGTGGAAGGTTGGACAGGTTAAACCCGGTGATTCCATTCAGTTTGTG CCACTTTCTTACGAAAGCTCGAGATCCTTAAAGGAATCTCAGGAAGTTGCAATTAAATCA TTGGATGGTACTAAGTTAAGGCGCTTAGACTCTGTTTCAATTTTACCATCATTCGAAACG CCTATTCTTGCACAAATGGAAAAAGTGAATGAGCTTTCACCAAAGGTTGTATACAGACAA GCAGGTGATCGTTATGTTTTGGTGGAATACGGTGATAATGAAATGAATTTTAATATTTCC TATAGAATTGAATGCCTGATCTCCCTTGTGAAAAAGAATAAGACTATTGGTATTGTTGAA ATGTCCCAAGGTGTTAGATCTGTGTTGATAGAATTTGATGGTTACAAAGTCACTCAAAAA GAATTGCTTAAAGTATTGGTGGCATATGAAACAGAAATCCAGTTTGATGAAAATTGGAAG ATAACTTCTAATATAATAAGATTACCGATGGCTTTCGAAGACTCGAAGACTTTGGCATGT GTTCAAAGGTATCAAGAAACAATTCGTTCGTCTGCTCCATGGTTGCCAAATAACGTTGAT TTCATTGCCAATGTAAATGGAATTTCAAGGAATGAAGTTTATGATATGTTGTATTCTGCC AGATTTATGGTTTTAGGTTTAGGTGATGTCTTCCTAGGGTCGCCTTGTGCTGTTCCATTA GATCCTCGTCACAGATTTTTGGGAAGCAAGTACAACCCAAGTAGAACATATACAGAAAGA GGTGCAGTCGGTATTGGCGGTATGTATATGTGCATATATGCTGCTAACAGTCCTGGTGGG TACCAATTAGTGGGTAGAACAATACCAATTTGGGACAAACTATGTCTGGCCGCATCTTCT GAGGTTCCGTGGTTGATGAACCCATTTGACCAAGTCGAATTTTACCCAGTTTCTGAAGAA GATTTGGATAAAATGACTGAAGATTGTGATAATGGTGTTTATAAAGTCAATATCGAAAAG AGTGTTTTTGATCATCAAGAATACTTGAGATGGATCAACGCAAACAAAGATTCCATCACA GCATTCCAGGAGGGCCAGCTTGGTGAAAGAGCAGAGGAATTTGCCAAATTGATTCAAAAT GCAAACTCTGAACTAAAAGAAAGTGTCACAGTCAAACCTGACGAGGAAGAAGACTTCCCA GAAGGTGCAGAAATTGTATATTCTGAGTATTCTGGGCGTTTTTGGAAATCCATAGCATCT GTTGGAGATGTTATTGAAGCAGGTCAAGGGCTACTAATTATTGAAGCCATGAAAGCGGAA ATGATTATATCCGCTCCTAAATCGGGTAAGATTATCAAGATTTGCCATGGCAATGGTGAT ATGGTTGATTCTGGTGACATAGTGGCCGTCATAGAGACATTGGCATGA
Protein Properties
Pfam Domain Function
Protein Residues1835
Protein Molecular Weight201830.0
Protein Theoretical pI5.3
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Urea amidolyase MTVSSDTTAEISLGWSIQDWIDFHKSSSSQASLRLLESLLDSQNVAPVDNAWISLISKEN LLHQFQILKSRENKETLPLYGVPIAVKDNIDVRGLPTTAACPSFAYEPSKDSKVVELLRN AGAIIVGKTNLDQFATGLVGTRSPYGKTPCAFSKEHVSGGSSAGSASVVARGIVPIALGT DTAGSGRVPAALNNLIGLKPTKGVFSCQGVVPACKSLDCVSIFALNLSDAERCFRIMCQP DPDNDEYSRPYVSNPLKKFSSNVTIAIPKNIPWYGETKNPVLFSNAVENLSRTGANVIEI DFEPLLELARCLYEGTWVAERYQAIQSFLDSKPPKESLDPTVISIIEGAKKYSAVDCFSF EYKRQGILQKVRRLLESVDVLCVPTCPLNPTMQQVADEPVLVNSRQGTWTNFVNLADLAA LAVPAGFRDDGLPNGITLIGKKFTDYALLELANRYFQNIFPNGSRTYGTFTSSSVKPAND QLVGPDYDPSTSIKLAVVGAHLKGLPLHWQLEKVNATYLCTTKTSKAYQLFALPKNGPVL KPGLRRVQDSNGSQIELEVYSVPKELFGAFISMVPEPLGIGSVELESGEWIKSFICEESG YKAKGTVDITKYGGFRAYFEMLKKKESQKKKLFDTVLIANRGEIAVRIIKTLKKLGIRSV AVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENA DFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPGSLLITSVEEAKKVAAE LEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVE VQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKC AGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVE VNGVSMEARLYAENPLKNFRPSPGLLVDVKFPDWARVDTWVKKGTNISPEYDPTLAKIIV HGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNILNSYQYEPTAI EITLPGAHTSIQDYPGRVGYWRIGVPPSGPMDAYSFRLANRIVGNDYRTPAIEVTLTGPS IVFHCETVIAITGGTALCTLDGQEIPQHKPVEVKRGSTLSIGKLTSGCRAYLGIRGGIDV PKYLGSYSTFTLGNVGGYNGRVLKLGDVLFLPSNEENKSVECLPQNIPQSLIPQISETKE WRIGVTCGPHGSPDFFKPESIEEFFSEKWKVHYNSNRFGVRLIGPKPKWARSNGGEGGMH PSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVPEAELWKVGQVKPGDSIQFV PLSYESSRSLKESQDVAIKSLDGTKLRRLDSVSILPSFETPILAQMEKVNELSPKVVYRQ AGDRYVLVEYGDNEMNFNISYRIECLISLVKKNKTIGIVEMSQGVRSVLIEFDGYKVTQK ELLKVLVAYETEIQFDENWKITSNIIRLPMAFEDSKTLACVQRYQETIRSSAPWLPNNVD FIANVNGISRNEVYDMLYSARFMVLGLGDVFLGSPCAVPLDPRHRFLGSKYNPSRTYTER GAVGIGGMYMCIYAANSPGGYQLVGRTIPIWDKLCLAASSEVPWLMNPFDQVEFYPVSEE DLDKMTEDCDNGVYKVNIEKSVFDHQEYLRWINANKDSITAFQEGQLGERAEEFAKLIQN ANSELKESVTVKPDEEEDFPEGAEIVYSEYSGRFWKSIASVGDVIEAGQGLLIIEAMKAE MIISAPKSGKIIKICHGNGDMVDSGDIVAVIETLA
References
External Links
ResourceLink
Saccharomyces Genome Database DUR1
Uniprot IDP32528
Uniprot NameDUR1_YEAST
GenBank Gene IDM64926
Genebank Protein ID173122
General Reference
  • Genbauffe, F. S., Cooper, T. G. (1991). "The urea amidolyase (DUR1,2) gene of Saccharomyces cerevisiae." DNA Seq 2:19-32.1802034
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Bussereau, F., Mallet, L., Gaillon, L., Jacquet, M. (1993). "A 12.8 kb segment, on the right arm of chromosome II from Saccharomyces cerevisiae including part of the DUR1,2 gene, contains five putative new genes." Yeast 9:797-806.8368014
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356