Identification
Name: Glutamine synthetase
Synonyms
  • GS
  • Glutamate--ammonia ligase
Gene Name: GLN1 Link_out
Enzyme Class:
Biological Properties
General Function: Involved in glutamate-ammonia ligase activity
Specific Function: ATP + L-glutamate + NH(3) = ADP + phosphate + L-glutamine
Cellular Location: Cytoplasm
Pathways:
  • Alanine, aspartate and glutamate metabolism 00250 Link_out
  • Arginine and proline metabolism 00330 Link_out
  • Nitrogen metabolism 00910 Link_out
  • Reactions:
    • ATP + L-glutamate + NH(3) = ADP + phosphate + L-glutamine.
    Metabolites:
    YMDB ID Name View
    YMDB00002L-Glutamine
    YMDB00091Ammonia
    YMDB00109Adenosine triphosphate
    YMDB00271L-Glutamic acid
    YMDB00423Ammonium
    YMDB00862hydron
    YMDB00907phosphate
    YMDB00914ADP
    GO Classification:
    Component
    Not Available
    Function
    ligase activity, forming carbon-nitrogen bonds
    acid-ammonia (or amide) ligase activity
    ammonia ligase activity
    catalytic activity
    glutamate-ammonia ligase activity
    ligase activity
    Process
    nitrogen compound metabolic process
    cellular metabolic process
    cellular amino acid and derivative metabolic process
    cellular amino acid metabolic process
    glutamine family amino acid metabolic process
    glutamine metabolic process
    metabolic process
    glutamine biosynthetic process
    Gene Properties
    Chromosome Location: chromosome 16
    Locus: YPR035W Link_out
    Gene Sequence:
    >1113 bp
    ATGGCTGAAGCAAGCATCGAAAAGACTCAAATTTTACAAAAATATCTAGAACTGGACCAA
    AGAGGTAGAATAATTGCCGAATACGTTTGGATCGATGGTACTGGTAACTTACGTTCCAAA
    GGTAGAACTTTGAAGAAGAGAATCACATCCATTGACCAATTGCCAGAATGGAACTTCGAC
    GGTTCTTCTACCAACCAAGCGCCAGGCCACGACTCTGACATCTATTTGAAACCCGTTGCT
    TACTACCCAGATCCCTTCAGGAGAGGTGACAACATTGTTGTCTTGGCCGCATGTTACAAC
    AATGACGGTACTCCAAACAAGTTCAACCACAGACACGAAGCTGCCAAGCTATTTGCTGCT
    CATAAGGATGAAGAAATCTGGTTTGGTCTAGAACAAGAATACACTCTATTTGACATGTAT
    GACGATGTTTACGGATGGCCAAAGGGTGGGTACCCAGCTCCACAAGGTCCTTACTACTGT
    GGTGTTGGTGCCGGTAAGGTTTATGCCAGAGACATGATCGAAGCTCACTACAGAGCTTGT
    TTGTATGCCGGATTAGAAATTTCTGGTATTAACGCTGAAGTCATGCCATCTCAATGGGAA
    TTCCAAGTCGGTCCATGTACCGGTATTGACATGGGTGACCAATTATGGATGGCCAGATAC
    TTTTTGCACAGAGTGGCAGAAGAGTTTGGTATCAAGATCTCATTCCATCCAAAGCCATTG
    AAGGGTGACTGGAACGGTGCCGGTTGTCACGCTAACGTTTCCACCAAGGAAATGAGACAA
    CCAGGTGGTACGAAATACATCGAACAAGCCATCGAGAAGTTATCCAAGAGACACGCTGAA
    CACATTAAGTTGTACGGTAGCGATAACGACATGAGATTAACTGGTAGACATGAAACCGCT
    TCCATGACTGCCTTTTCTTCTGGTGTCGCCAACAGAGGTAGCTCAATTAGAATCCCAAGA
    TCCGTCGCCAAGGAAGGTTACGGTTACTTTGAAGACCGTAGACCAGCTTCCAACATCGAC
    CCATACTTGGTTACAGGTATCATGTGTGAAACTGTTTGCGGTGCTATTGACAATGCTGAC
    ATGACGAAGGAATTTGAAAGAGAATCTTCATAA
    Protein Properties
    Pfam Domain Function:
    Protein Residues: 370
    Protein Molecular Weight: 41705.60156
    Protein Theoretical pI: 6.29
    Signalling Regions:
    • None
    Transmembrane Regions:
    • None
    Protein Sequence:
    >Glutamine synthetase
    MAEASIEKTQILQKYLELDQRGRIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFD
    GSSTNQAPGHDSDIYLKPVAYYPDPFRRGDNIVVLAACYNNDGTPNKFNHRHEAAKLFAA
    HKDEEIWFGLEQEYTLFDMYDDVYGWPKGGYPAPQGPYYCGVGAGKVYARDMIEAHYRAC
    LYAGLEISGINAEVMPSQWEFQVGPCTGIDMGDQLWMARYFLHRVAEEFGIKISFHPKPL
    KGDWNGAGCHANVSTKEMRQPGGTKYIEQAIEKLSKRHAEHIKLYGSDNDMRLTGRHETA
    SMTAFSSGVANRGSSIRIPRSVAKEGYGYFEDRRPASNIDPYLVTGIMCETVCGAIDNAD
    MTKEFERESS
    References
    External Links:
    Resource Link
    Saccharomyces Genome Database: GLN1 Link_out
    Uniprot ID: P32288 Link_out
    Uniprot Name: GLNA_YEAST Link_out
    GenBank Gene ID: Z68111 Link_out
    Genebank Protein ID: 1072403 Link_out
    General Reference:
    • Minehart, P. L., Magasanik, B. (1992). "Sequence of the GLN1 gene of Saccharomyces cerevisiae: role of the upstream region in regulation of glutamine synthetase expression." J Bacteriol 174:1828-1836. Pubmed: 1347768 Link_out
    • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105. Pubmed: 9169875 Link_out
    • Kim, K. H., Rhee, S. G. (1988). "Sequence of peptides from Saccharomyces cerevisiae glutamine synthetase. N-terminal peptide and ATP-binding domain." J Biol Chem 263:833-838. Pubmed: 2891705 Link_out
    • Garrels, J. I., McLaughlin, C. S., Warner, J. R., Futcher, B., Latter, G. I., Kobayashi, R., Schwender, B., Volpe, T., Anderson, D. S., Mesquita-Fuentes, R., Payne, W. E. (1997). "Proteome studies of Saccharomyces cerevisiae: identification and characterization of abundant proteins." Electrophoresis 18:1347-1360. Pubmed: 9298649 Link_out
    • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741. Pubmed: 14562106 Link_out
    • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926. Pubmed: 12872131 Link_out
    • Hitchcock, A. L., Auld, K., Gygi, S. P., Silver, P. A. (2003). "A subset of membrane-associated proteins is ubiquitinated in response to mutations in the endoplasmic reticulum degradation machinery." Proc Natl Acad Sci U S A 100:12735-12740. Pubmed: 14557538 Link_out