You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGeneral amino acid permease AGP1
Synonyms
  • Asparagine/glutamine permease
Gene NameAGP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionBroad substrate range permease which transports asparagine and glutamine with intermediate specificity. Also transports Ala, Cys, Gly, Ile, Leu, Met, Phe, Ser, Thr, Tyr and Val. Important for the utilization of amino acids as a nitrogen source
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00016GlycineShow
YMDB00038L-IsoleucineShow
YMDB00046L-CysteineShow
YMDB00112L-SerineShow
YMDB00152L-ValineShow
YMDB00154L-AlanineShow
YMDB00214L-ThreonineShow
YMDB00226L-AsparagineShow
YMDB00271L-Glutamic acidShow
YMDB00304L-PhenylalanineShow
YMDB00318L-MethionineShow
YMDB00364L-TyrosineShow
YMDB00369L-HistidineShow
YMDB00387L-LeucineShow
YMDB00862hydronShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 3
LocusYCL025C
Gene Sequence>gi|330443489:c77919-76018 Saccharomyces cerevisiae S288c chromosome III, complete sequence ATGTCGTCGTCGAAGTCTCTATACGAACTGAAAGACTTGAAAAATAGCTCCACAGAAATA CATGCCACGGGGCAGGATAATGAAATTGAATATTTCGAAACAGGCTCCAATGACCGTCCA TCCTCACAACCTCATTTAGGTTACGAACAGCATAACACTTCTGCCGTGCGTAGGTTTTTC GACTCCTTTAAAAGAGCGGATCAGGGTCCACAGGATGAAGTAGAAGCAACACAAATGAAC GATCTTACGTCGGCTATCTCACCTTCTTCTAGACAGGCTCAAGAACTAGAAAAAAATGAA AGTTCGGACAACATAGGCGCTAATACAGGTCATAAGTCGGACTCGCTGAAGAAAACCATT CAGCCTAGACATGTTCTGATGATTGCGTTGGGTACGGGTATCGGTACTGGGTTATTGGTC GGTAACGGTACCGCGTTGGTTCATGCGGGTCCAGCTGGACTACTTATTGGTTACGCTATT ATGGGTTCTATCTTGTACTGTATTATTCAAGCATGTGGTGAAATGGCGCTAGTGTATAGT AACTTGACTGGTGGCTACAATGCATACCCCAGTTTCCTTGTGGATGATGGTTTTGGGTTT GCAGTCGCTTGGGTTTATTGTTTGCAATGGCTGTGTGTGTGTCCTCTGGAATTGGTGACC GCATCCATGACTATCAAATATTGGACGACATCTGTGAACCCGGATGTGTTCGTCATTATT TTCTATGTTTTGGTGATTACTATTAATATTTTCGGTGCTCGTGGTTATGCAGAAGCTGAG TTCTTCTTCAACTGTTGCAAAATTTTGATGATGACTGGGTTCTTCATTCTTGGTATTATC ATCGATGTTGGTGGCGCTGGTAATGATGGTTTTATTGGTGGTAAATACTGGCACGATCCG GGCGCTTTCAATGGTAAACATGCCATTGACAGATTTAAAGGTGTTGCTGCAACATTAGTG ACTGCTGCTTTTGCCTTTGGTGGTTCAGAGTTTATTGCCATCACCACTGCAGAACAATCT AATCCAAGAAAGGCCATTCCAGGTGCGGCCAAACAAATGATCTACAGAATCTTATTCCTA TTCTTGGCTACCATTATTCTACTGGGTTTCTTGGTGCCATACAATTCCGATCAATTATTG GGTTCTACCGGTGGTGGTACTAAAGCCTCGCCATATGTCATTGCTGTTGCATCCCACGGT GTCCGTGTCGTCCCACACTTCATTAACGCCGTTATTCTACTTTCCGTGCTGTCCATGGCT AACTCCTCCTTCTACTCCAGTGCTCGTTTATTTTTAACTCTATCCGAGCAAGGTTACGCT CCTAAGGTTTTCTCCTACATCGACAGAGCCGGTAGACCATTGATTGCCATGGGTGTTTCT GCATTGTTTGCCGTTATTGCCTTCTGTGCTGCATCTCCCAAGGAAGAACAAGTTTTCACT TGGTTATTGGCCATTTCTGGTTTGTCTCAGCTTTTCACATGGACTGCCATTTGTTTATCC CATCTTAGATTTAGAAGAGCCATGAAAGTCCAAGGGAGATCTCTTGGAGAATTGGGTTTC AAATCTCAAACTGGTGTTTGGGGATCTGCCTACGCTTGCATTATGATGATTTTAATTCTT ATTGCCCAATTTTGGGTCGCTATCGCCCCCATTGGTGAAGGTAAGCTGGATGCACAAGCC TTTTTCGAAAACTACTTGGCTATGCCAATCTTGATTGCACTTTATGTCGGCTACAAGGTC TGGCACAAGGATTGGAAACTGTTCATCAGGGCAGACAAGATCGACCTAGATTCTCATAGA CAAATCTTTGATGAAGAATTAATCAAGCAAGAAGACGAAGAATATAGGGAACGTTTGAGG AACGGACCTTATTGGAAAAGGGTCGTTGCCTTCTGGTGTTAA
Protein Properties
Pfam Domain Function
Protein Residues633
Protein Molecular Weight69670.70313
Protein Theoretical pI6.97
Signalling Regions
  • None
Transmembrane Regions
  • 125-145
  • 149-169
  • 198-218
  • 232-252
  • 261-281
  • 314-334
  • 353-373
  • 403-425
  • 453-473
  • 478-498
  • 532-552
  • 561-581
Protein Sequence>General amino acid permease AGP1 MSSSKSLYELKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFF DSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTI QPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYS NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVII FYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDP GAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFL FLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSMA NSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFT WLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILIL IAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHR QIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC
References
External Links
ResourceLink
Saccharomyces Genome Database AGP1
Uniprot IDP25376
Uniprot NameAGP1_YEAST
General Reference
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Schreve, J. L., Sin, J. K., Garrett, J. M. (1998). "The Saccharomyces cerevisiae YCC5 (YCL025c) gene encodes an amino acid permease, Agp1, which transports asparagine and glutamine." J Bacteriol 180:2556-2559.9573211
  • During-Olsen, L., Regenberg, B., Gjermansen, C., Kielland-Brandt, M. C., Hansen, J. (1999). "Cysteine uptake by Saccharomyces cerevisiae is accomplished by multiple permeases." Curr Genet 35:609-617.10467005
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Iraqui, I., Vissers, S., Bernard, F., de Craene, J. O., Boles, E., Urrestarazu, A., Andre, B. (1999). "Amino acid signaling in Saccharomyces cerevisiae: a permease-like sensor of external amino acids and F-Box protein Grr1p are required for transcriptional induction of the AGP1 gene, which encodes a broad-specificity amino acid permease." Mol Cell Biol 19:989-1001.9891035
  • Forsberg, H., Ljungdahl, P. O. (2001). "Genetic and biochemical analysis of the yeast plasma membrane Ssy1p-Ptr3p-Ssy5p sensor of extracellular amino acids." Mol Cell Biol 21:814-826.11154269
  • Brachat, S., Dietrich, F. S., Voegeli, S., Zhang, Z., Stuart, L., Lerch, A., Gates, K., Gaffney, T., Philippsen, P. (2003). "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii." Genome Biol 4:R45.12844361
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Schreve, J. L., Garrett, J. M. (2004). "Yeast Agp2p and Agp3p function as amino acid permeases in poor nutrient conditions." Biochem Biophys Res Commun 313:745-751.14697254
  • Abdel-Sater, F., Iraqui, I., Urrestarazu, A., Andre, B. (2004). "The external amino acid signaling pathway promotes activation of Stp1 and Uga35/Dal81 transcription factors for induction of the AGP1 gene in Saccharomyces cerevisiae." Genetics 166:1727-1739.15126393
  • Roth, A. F., Wan, J., Bailey, A. O., Sun, B., Kuchar, J. A., Green, W. N., Phinney, B. S., Yates, J. R. 3rd, Davis, N. G. (2006). "Global analysis of protein palmitoylation in yeast." Cell 125:1003-1013.16751107
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956