Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAnthranilate synthase component 2
Synonyms
  • Anthranilate synthase component II
  • Glutamine amidotransferase
  • Indole-3-glycerol phosphate synthase
  • PRAI
Gene NameTRP3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionChorismate + L-glutamine = anthranilate + pyruvate + L-glutamate
Cellular LocationNot Available
SMPDB Pathways
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
Chorismate + L-GlutaminePyruvic acid + L-Glutamic acid + hydron + 2-Aminobenzoic acid
KEGG Reactions
1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate + hydron1-C-(indol-3-yl)glycerol 3-phosphate + Carbon dioxide + water
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00148ChorismateShow
YMDB00175Pyruvic acidShow
YMDB002511-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphateShow
YMDB00271L-Glutamic acidShow
YMDB002782-Aminobenzoic acidShow
YMDB007091-C-(indol-3-yl)glycerol 3-phosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
oxo-acid-lyase activity
anthranilate synthase activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
indole-3-glycerol-phosphate synthase activity
catalytic activity
Process
tryptophan metabolic process
biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
glutamine metabolic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
metabolic process
indolalkylamine metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL211C
Gene Sequence>1455 bp ATGTCTGTGCACGCTGCAACAAACCCAATCAATAAGCATGTGGTTCTAATTGACAACTAC GATTCCTTTACCTGGAACGTTTACGAGTACTTGTGCCAGGAGGGCGCCAAAGTGAGCGTC TACCGTAACGATGCAATTACAGTTCCAGAAATTGCCGCCTTGAATCCCGACACATTGCTT ATCTCGCCTGGACCAGGCCACCCAAAGACAGATTCTGGCATTTCAAGAGACTGTATCCGG TACTTTACTGGGAAAATTCCTGTATTTGGAATCTGTATGGGCCAGCAATGCATGTTTGAC GTATTTGGTGGTGAAGTTGCCTACGCTGGTGAGATTGTCCACGGTAAAACGTCCCCAATC TCTCACGACAACTGTGGAATTTTCAGGAACGTGCCGCAAGGTATTGCTGTGACAAGATAC CATTCATTGGCCGGGACAGAATCGTCCCTACCATCCTGCTTGAAGGTTACTGCGAGTACC GAAAATGGAATTATCATGGGTGTAAGACACAAGAAGTACACTGTAGAAGGTGTGCAATTT CATCCGGAATCCATCTTGACCGAGGAAGGTCATCTGATGATCAGGAACATTTTAAACGTC AGTGGAGGCACTTGGGAGGAAAACAAATCATCTCCTTCAAATTCTATTTTGGACCGTATC TATGCTCGGCGTAAAATAGACGTCAATGAGCAGTCTAAAATCCCAGGTTTCACCTTTCAA GACTTACAATCTAACTATGATTTAGGTCTTGCCCCACCGTTACAGGATTTCTACACGGTG TTGTCATCATCCCATAAAAGAGCCGTTGTTCTTGCTGAAGTCAAGCGTGCCTCTCCATCG AAGGGACCCATTTGTTTAAAAGCTGTTGCTGCTGAACAGGCTCTCAAATACGCAGAGGCT GGTGCATCCGCAATTTCCGTATTGACCGAACCTCATTGGTTTCACGGTTCGTTACAGGAT TTAGTAAATGTGAGGAAAATCCTAGATTTGAAATTTCCTCCCAAGGAGAGGCCTTGTGTT TTGAGAAAAGAATTTATTTTCAGCAAGTATCAAATACTAGAAGCAAGATTAGCTGGAGCT GACACTGTCCTTCTTATAGTCAAGATGCTATCTCAACCCTTATTGAAGGAACTGTACAGC TACAGTAAAGATTTGAACATGGAACCTCTCGTTGAGGTGAACTCCAAAGAGGAATTACAA AGGGCTCTAGAAATTGGTGCTAAAGTTGTAGGTGTCAATAATAGGGACCTGCATTCATTC AACGTAGACCTAAATACCACCAGTAACTTGGTAGAATCTATTCCAAAGGATGTTCTTCTA ATTGCTCTATCGGGAATTACCACCAGGGACGATGCTGAAAAATACAAAAAAGAAGGTGTC CATGGATTTTTAGTGGGTGAAGCCCTAATGAAATCAACCGATGTGAAGAAGTTCATTCAT GAATTATGCGAATAA
Protein Properties
Pfam Domain Function
Protein Residues484
Protein Molecular Weight53488.89844
Protein Theoretical pI6.91
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Anthranilate synthase component 2 MSVHAATNPINKHVVLIDNYDSFTWNVYEYLCQEGAKVSVYRNDAITVPEIAALNPDTLL ISPGPGHPKTDSGISRDCIRYFTGKIPVFGICMGQQCMFDVFGGEVAYAGEIVHGKTSPI SHDNCGIFKNVPQGIAVTRYHSLAGTESSLPSCLKVTASTENGIIMGVRHKKYTVEGVQF HPESILTEEGHLMIRNILNVSGGTWEENKSSPSNSILDRIYARRKIDVNEQSKIPGFTFQ DLQSNYDLGLAPPLQDFYTVLSSSHKRAVVLAEVKRASPSKGPICLKAVAAEQALKYAEA GASAISVLTEPHWFHGSLQDLVNVRKILDLKFPPKERPCVLRKEFIFSKYQILEARLAGA DTVLLIVKMLSQPLLKELYSYSKDLNMEPLVEVNSKEELQRALEIGAKVVGVNNRDLHSF NVDLNTTSNLVESIPKDVLLIALSGITTRDDAEKYKKEGVHGFLVGEALMKSTDVKKFIH ELCE
References
External Links
ResourceLink
Saccharomyces Genome Database TRP3
Uniprot IDP00937
Uniprot NameTRPG_YEAST
GenBank Gene IDK01386
Genebank Protein ID173045
General Reference
  • Zalkin, H., Paluh, J. L., van Cleemput, M., Moye, W. S., Yanofsky, C. (1984). "Nucleotide sequence of Saccharomyces cerevisiae genes TRP2 and TRP3 encoding bifunctional anthranilate synthase: indole-3-glycerol phosphate synthase." J Biol Chem 259:3985-3992.6323449
  • Tzermia, M., Horaitis, O., Alexandraki, D. (1994). "The complete sequencing of a 24.6 kb segment of yeast chromosome XI identified the known loci URA1, SAC1 and TRP3, and revealed 6 new open reading frames including homologues to the threonine dehydratases, membrane transporters, hydantoinases and the phospholipase A2-activating protein." Yeast 10:663-679.7941750
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956