You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtein farnesyltransferase subunit beta
Synonyms
  • FTase-beta
  • CAAX farnesyltransferase subunit beta
  • Ras proteins prenyltransferase subunit beta
Gene NameRAM1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the transfer of a farnesyl moiety from farnesyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins such as a-factor and RAS. The beta subunit is responsible for peptide-binding
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB00229Farnesyl pyrophosphateShow
YMDB004954-Hydroxybenzoic acidShow
YMDB00614nonaprenyl diphosphateShow
YMDB00615nonaprenyl 4-hydroxybenzoateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDL090C
Gene Sequence>1296 bp ATGCGACAGAGAGTAGGAAGGTCCATAGCTAGGGCTAAATTTATAAATACTGCCTTATTA GGAAGAAAGAGACCAGTTATGGAAAGAGTCGTCGATATAGCGCATGTAGATTCAAGTAAA GCAATCCAACCATTGATGAAGGAACTAGAAACCGACACTACAGAAGCACGATACAAAGTA CTACAAAGTGTATTAGAGATATACGATGATGAAAAGAATATAGAACCTGCTCTCACGAAA GAGTTTCACAAAATGTACTTGGATGTCGCTTTTGAGATATCGTTACCTCCACAAATGACA GCACTAGATGCTTCACAACCGTGGATGCTATATTGGATTGCTAACTCATTGAAGGTAATG GACAGAGACTGGCTTTCAGATGACACCAAAAGAAAAATTGTAGATAAGCTCTTTACTATT AGTCCTTCAGGAGGACCCTTTGGTGGAGGTCCTGGCCAATTATCTCATTTGGCCAGCACT TATGCTGCAATTAATGCTCTCTCCCTTTGCGATAACATAGATGGATGCTGGGACAGAATT GATCGAAAAGGAATTTACCAATGGCTGATATCGTTGAAAGAGCCTAATGGAGGATTCAAG ACCTGTTTAGAAGTCGGAGAAGTGGATACAAGAGGTATATACTGTGCCTTGAGCATAGCA ACCTTATTAAATATTCTTACAGAAGAGCTTACAGAAGGTGTGTTAAACTATTTGAAAAAT TGTCAAAATTATGAAGGTGGATTCGGCAGTTGTCCTCACGTAGATGAGGCACACGGAGGC TATACTTTCTGTGCTACAGCTAGTCTAGCAATTTTAAGGTCCATGGACCAAATAAATGTT GAAAAGCTTTTAGAATGGTCTAGTGCTCGTCAATTGCAAGAAGAACGAGGATTTTGCGGA AGGAGCAACAAACTTGTTGACGGTTGCTATAGTTTTTGGGTTGGAGGTTCGGCTGCCATT CTTGAAGCTTTTGGATATGGCCAATGCTTCAACAAACATGCTCTTCGGGACTACATATTG TACTGTTGCCAAGAAAAAGAGCAACCTGGTTTGAGAGATAAACCAGGGGCCCACTCAGAC TTTTACCATACAAATTATTGCCTATTAGGACTGGCTGTTGCGGAAAGTTCATACAGTTGC ACTCCTAATGATTCTCCACATAATATTAAGTGTACTCCAGACCGCCTAATTGGATCATCG AAACTTACTGATGTCAACCCTGTCTATGGTTTACCAATAGAAAATGTAAGAAAAATTATC CACTACTTTAAATCCAATTTATCTTCTCCAAGTTAA
Protein Properties
Pfam Domain Function
Protein Residues431
Protein Molecular Weight48189.39844
Protein Theoretical pI6.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Protein farnesyltransferase subunit beta MRQRVGRSIARAKFINTALLGRKRPVMERVVDIAHVDSSKAIQPLMKELETDTTEARYKV LQSVLEIYDDEKNIEPALTKEFHKMYLDVAFEISLPPQMTALDASQPWMLYWIANSLKVM DRDWLSDDTKRKIVDKLFTISPSGGPFGGGPGQLSHLASTYAAINALSLCDNIDGCWDRI DRKGIYQWLISLKEPNGGFKTCLEVGEVDTRGIYCALSIATLLNILTEELTEGVLNYLKN CQNYEGGFGSCPHVDEAHGGYTFCATASLAILRSMDQINVEKLLEWSSARQLQEERGFCG RSNKLVDGCYSFWVGGSAAILEAFGYGQCFNKHALRDYILYCCQEKEQPGLRDKPGAHSD FYHTNYCLLGLAVAESSYSCTPNDSPHNIKCTPDRLIGSSKLTDVNPVYGLPIENVRKII HYFKSNLSSPS
References
External Links
ResourceLink
Saccharomyces Genome Database RAM1
Uniprot IDP22007
Uniprot NameFNTB_YEAST
GenBank Gene IDM22753
Genebank Protein ID171420
General Reference
  • Goodman, L. E., Perou, C. M., Fujiyama, A., Tamanoi, F. (1988). "Structure and expression of yeast DPR1, a gene essential for the processing and intracellular localization of ras proteins." Yeast 4:271-281.3064491
  • Boskovic, J., Soler-Mira, A., Garcia-Cantalejo, J. M., Ballesta, J. P., Jimenez, A., Remacha, M. (1996). "The sequence of a 16,691 bp segment of Saccharomyces cerevisiae chromosome IV identifies the DUN1, PMT1, PMT5, SRP14 and DPR1 genes, and five new open reading frames." Yeast 12:1377-1384.8923743
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956