You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUridine nucleosidase
Synonyms
  • Uridine ribohydrolase
Gene NameURH1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing N-glycosyl compounds
Specific FunctionAlso acts on cytidine
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB Reactions
Nicotinamide riboside + waterhydron + D-Ribose + Niacinamide
KEGG Reactions
Adenosine + waterD-Ribose + Adenine
water + GuanosineD-Ribose + Guanine
Metabolites
YMDB IDNameView
YMDB00058AdenosineShow
YMDB00061Ribose 1-phosphateShow
YMDB00098UracilShow
YMDB00103Nicotinamide ribosideShow
YMDB00127UridineShow
YMDB00253D-RiboseShow
YMDB00274NiacinamideShow
YMDB00509GuanosineShow
YMDB00698GuanineShow
YMDB00862hydronShow
YMDB00887AdenineShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing N-glycosyl compounds
catalytic activity
hydrolase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR400W
Gene Sequence>YDR400W Chr 4 ATGACTGTTAGTAAAATACCCATATGGCTAGATTGTGATCCTGGTCATGATGATGCCATA GCCATTTTATTAGGCTGTTTCCATCCAGCTTTCAATCTTCTAGGAATCAGCACGTGTTTT GGTAACGCACCGCCAGAGAATACTGACTACAACGCCCGTTCTCTTTTGACTGCGATGGGC AAAGCACAAGCGATTCCAGTTTATAAAGGCGCACAGAGACCTTGGAAAAGGGAACCTCAT TATGCTCCTGACATTCATGGTATATCAGGTTTAGACGGCACTTCTTTGCTACCTAAGCCA ACATTTGAGGCAAGAACTGATAAAACGTATATTGAGGCCATTGAAGAGGCGATTCTAGCT AACAATGGAGAGATATCCTTTGTGTCTACTGGTGCACTTACCACATTAGCAACAGTTTTT AGGTGTAAACCATACCTAAAAAAATCTGTCAAATATATTAGCATTATGGGGGGTGGACTC CATGGTCTAGGAAACTGTAACCCAAATCTTTCTGCTGAATTCAACGTTTGGATTGATCCT GACGCAGCGAATTACATATTCCGTGATCCCGATGTAAAGGACAAATGTATAGTAGTTCCT CTAAATTTAACTCACAAGGCCATAGCTACTTACAAGGTTAACGAAATGATATACAACGAA AAGAATAACAGCAAGTTACGAGAATTGTTTTTGGAGCTTTTTCAATTTTTTGCTCATACC TACAAGGATATGCAAGGATTTGAATCGGGCCCACCTATACATGATCCGGTAGCTTTGATG CCGCTTTTGGAATTTTATGGGTGGGATCCATCGTCTGCGGTTGGATTTCGCTACAAGAGA ATGGACATATCCTGCATTGATGATGTTTTCAACGAAAACTCAGGGAAAATTATCATTGAA AAAGAATATCCAAATGACAGTGATGTTGGTACAATAATTGGTCTCGATTTGAATATCCAG TACTTTTGGGATCAGATTTTTGAAGCATTAAATAGAGCAGACAAAATGTCAACGATTGGA TAA
Protein Properties
Pfam Domain Function
Protein Residues340
Protein Molecular Weight37960.0
Protein Theoretical pI5.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uridine nucleosidase MTVSKIPIWLDCDPGHDDAIAILLGCFHPAFNLLGISTCFGNAPPENTDYNARSLLTAMG KAQAIPVYKGAQRPWKREPHYAPDIHGISGLDGTSLLPKPTFEARTDKTYIEAIEEAILA NNGEISFVSTGALTTLATVFRCKPYLKKSVKYISIMGGGLHGLGNCNPNLSAEFNVWIDP DAANYIFRDPDVKDKCIVVPLNLTHKAIATYKVNEMIYNEKNNSKLRELFLELFQFFAHT YKDMQGFESGPPIHDPVALMPLLEFYGWDPSSAVGFRYKRMDISCIDDVFNENSGKIIIE KEYPNDSDVGTIIGLDLNIQYFWDQIFEALNRADKMSTIG
References
External Links
ResourceLink
Saccharomyces Genome Database URH1
Uniprot IDQ04179
Uniprot NameURH1_YEAST
General Reference
  • Kurtz, J. E., Exinger, F., Erbs, P., Jund, R. (2002). "The URH1 uridine ribohydrolase of Saccharomyces cerevisiae." Curr Genet 41:132-141.12111094
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Magni, G., Fioretti, E., Ipata, P. L., Natalini, P. (1975). "Bakers' yeast uridine nucleosidase. Purification, composition, and physical and enzymatic properties." J Biol Chem 250:9-13.237897
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095