You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenosine deaminase
Synonyms
  • Adenosine aminohydrolase
Gene NameAAH1
Enzyme Class
Biological Properties
General FunctionInvolved in deaminase activity
Specific FunctionAdenosine + H(2)O = inosine + NH(3)
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
water + hydron + AdenineHypoxanthine + Ammonium
Adenosine + water + hydronAmmonium + Inosine
water + hydron + 2'-Deoxyadenosine2'-Deoxyinosine + Ammonium
Metabolites
YMDB IDNameView
YMDB00058AdenosineShow
YMDB00091AmmoniaShow
YMDB00423AmmoniumShow
YMDB005032'-DeoxyadenosineShow
YMDB00510InosineShow
YMDB00555HypoxanthineShow
YMDB006592'-DeoxyinosineShow
YMDB00862hydronShow
YMDB00887AdenineShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
adenosine deaminase activity
deaminase activity
catalytic activity
hydrolase activity
Process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside monophosphate biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL141W
Gene Sequence>1044 bp ATGGTTTCTGTGGAGTTTTTACAGGAGTTACCAAAATGTGAGCATCACTTGCATTTGGAA GGTACTCTAGAACCTGACCTATTGTTCCCATTAGCTAAAAGAAACGATATAATTCTACCT GAAGGTTTTCCTAAATCGGTCGAGGAATTAAACGAAAAGTATAAGAAGTTTCGTGATCTG CAGGATTTCTTAGATTACTATTATATTGGTACTAATGTCTTGATTAGTGAACAAGATTTC TTTGATTTGGCGTGGGCCTATTTTAAAAAAGTTCACAAACAAGGCTTGGTCCATGCTGAA GTGTTTTACGACCCTCAGTCACATACATCTAGGGGCATCTCCATAGAAACAGTCACTAAA GGTTTCCAAAGAGCTTGTGACAAAGCCTTCTCTGAATTTGGTATTACATCCAAGCTAATT ATGTGTCTGTTAAGACACATTGAACCAGAGGAATGTTTGAAAACTATCGAAGAAGCTACC CCATTTATTAAAGATGGTACTATCTCTGCCTTAGGATTAGATTCTGCTGAGAAACCATTT CCCCCACATTTATTTGTTGAATGTTACGGAAAGGCCGCCTCATTGAATAAAGATTTAAAA CTAACTGCACACGCAGGTGAAGAAGGCCCCGCTCAATTCGTCTCGGATGCTTTAGACTTG TTGCAAGTAACAAGAATCGATCACGGTATCAACAGTCAATACGACGAGGAGTTATTGGAT AGGTTGTCGCGCGACCAGACCATGCTAACTATTTGTCCTCTCTCCAACGTGAAGCTACAA GTAGTCCAATCCGTTTCAGAGTTACCACTACAAAAGTTTCTTGACAGAGATGTTCCATTT TCTTTAAATTCTGATGACCCCGCCTATTTTGGTGGTTATATCTTAGATGTCTACACTCAA GTTTCGAAAGATTTCCCACACTGGGACCATGAAACATGGGGTCGTATCGCTAAGAACGCC ATTAAAGGTTCATGGTGTGACGATAAAAGAAAGAACGGTTTGTTAAGTAGAGTGGACGAA GTAGTCACTAAATATTCGCATTAG
Protein Properties
Pfam Domain Function
Protein Residues347
Protein Molecular Weight39634.69922
Protein Theoretical pI5.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenosine deaminase MVSVEFLQELPKCEHHLHLEGTLEPDLLFPLAKRNDIILPEGFPKSVEELNEKYKKFRDL QDFLDYYYIGTNVLISEQDFFDLAWAYFKKVHKQGLVHAEVFYDPQSHTSRGISIETVTK GFQRACDKAFSEFGITSKLIMCLLRHIEPEECLKTIEEATPFIKDGTISALGLDSAEKPF PPHLFVECYGKAASLNKDLKLTAHAGEEGPAQFVSDALDLLQVTRIDHGINSQYDEELLD RLSRDQTMLTICPLSNVKLQVVQSVSELPLQKFLDRDVPFSLNSDDPAYFGGYILDVYTQ VSKDFPHWDHETWGRIAKNAIKGSWCDDKRKNGLLSRVDEVVTKYSH
References
External Links
ResourceLink
Saccharomyces Genome Database AAH1
Uniprot IDP53909
Uniprot NameADA_YEAST
GenBank Gene IDZ46843
Genebank Protein ID854497
General Reference
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Mallet, L., Bussereau, F., Jacquet, M. (1995). "A 43.5 kb segment of yeast chromosome XIV, which contains MFA2, MEP2, CAP/SRV2, NAM9, FKB1/FPR1/RBP1, MOM22 and CPT1, predicts an adenosine deaminase gene and 14 new open reading frames." Yeast 11:1195-1209.8619318
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Deeley, M. C. (1992). "Adenine deaminase and adenine utilization in Saccharomyces cerevisiae." J Bacteriol 174:3102-3110.1577682
  • Escusa, S., Laporte, D., Massoni, A., Boucherie, H., Dautant, A., Daignan-Fornier, B. (2007). "Skp1-Cullin-F-box-dependent degradation of Aah1p requires its interaction with the F-box protein Saf1p." J Biol Chem 282:20097-20103.17517885
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Ribard, C., Rochet, M., Labedan, B., Daignan-Fornier, B., Alzari, P., Scazzocchio, C., Oestreicher, N. (2003). "Sub-families of alpha/beta barrel enzymes: a new adenine deaminase family." J Mol Biol 334:1117-1131.14643670