You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBranched-chain-amino-acid aminotransferase, cytosolic
Synonyms
  • BCAT
  • Protein TWT2
Gene NameBAT2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. Involved in cell cycle regulation
Cellular LocationCytoplasm
SMPDB Pathways
Isoleucine degradationPW002491 ThumbThumb?image type=greyscaleThumb?image type=simple
Leucine DegradationPW002490 ThumbThumb?image type=greyscaleThumb?image type=simple
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
Valine DegradationPW002489 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
Valine, leucine and isoleucine biosynthesisec00290 Map00290
Valine, leucine and isoleucine degradationec00280 Map00280
SMPDB Reactions
L-Valine + Oxoglutaric acidL-Glutamic acid + Alpha-Ketoisovaleric acid
L-Leucine + Oxoglutaric acidL-Glutamic acid + Ketoleucine
L-Isoleucine + hydronCarbon dioxide + (S)-3-methyl-2-oxovaleric acid
KEGG Reactions
(2S)-2-Isopropyl-3-oxosuccinate + hydronKetoleucine + Carbon dioxide
Oxoglutaric acid + L-IsoleucineL-Glutamic acid + (S)-3-methyl-2-oxovaleric acid
L-Leucine + Oxoglutaric acidKetoleucine + L-Glutamic acid
Oxoglutaric acid + L-ValineL-Glutamic acid + Alpha-Ketoisovaleric acid
Metabolites
YMDB IDNameView
YMDB00038L-IsoleucineShow
YMDB00152L-ValineShow
YMDB00153Oxoglutaric acidShow
YMDB00168(S)-3-methyl-2-oxovaleric acidShow
YMDB00271L-Glutamic acidShow
YMDB00365Alpha-Ketoisovaleric acidShow
YMDB00387L-LeucineShow
YMDB00388KetoleucineShow
YMDB00449(2S)-2-Isopropyl-3-oxosuccinateShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
transferase activity, transferring nitrogenous groups
transaminase activity
branched-chain-amino-acid transaminase activity
catalytic activity
transferase activity
Process
cellular amino acid metabolic process
branched chain family amino acid metabolic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR148W
Gene Sequence>1131 bp ATGACCTTGGCACCCCTAGACGCCTCCAAAGTTAAGATAACTACCACACAACATGCATCT AAGCCAAAACCGAACAGTGAGTTAGTGTTTGGCAAGAGCTTCACGGACCACATGTTAACT GCGGAATGGACAGCTGAAAAAGGGTGGGGTACCCCAGAGATTAAACCTTATCAAAATCTG TCTTTAGACCCTTCCGCGGTGGTTTTCCATTATGCTTTTGAGCTATTCGAAGGGATGAAG GCTTACAGAACGGTGGACAACAAAATTACAATGTTTCGTCCAGATATGAATATGAAGCGC ATGAATAAGTCTGCTCAGAGAATCTGTTTGCCAACGTTCGACCCAGAAGAGTTGATTACC CTAATTGGGAAACTGATCCAGCAAGATAAGTGCTTAGTTCCTGAAGGAAAAGGTTACTCT TTATATATCAGGCCTACATTAATCGGCACTACGGCCGGTTTAGGGGTTTCCACGCCTGAT AGAGCCTTGCTATATGTCATTTGCTGCCCTGTGGGTCCTTATTACAAAACTGGATTTAAG GCGGTCAGACTGGAAGCCACTGATTATGCCACAAGAGCTTGGCCAGGAGGCTGTGGTGAC AAGAAACTAGGTGCAAACTACGCCCCCTGCGTCCTGCCACAATTGCAAGCTGCTTCAAGG GGTTACCAACAAAATTTATGGCTATTTGGTCCAAATAACAACATTACTGAAGTCGGCACC ATGAATGCTTTTTTCGTGTTTAAAGATAGTAAAACGGGCAAGAAGGAACTAGTTACTGCT CCACTAGACGGTACCATTTTGGAAGGTGTTACTAGGGATTCCATTTTAAATCTTGCTAAA GAAAGACTCGAACCAAGTGAATGGACCATTAGTGAACGCTACTTCACTATAGGCGAAGTT ACTGAGAGATCCAAGAACGGTGAACTACTTGAAGCCTTTGGTTCTGGTACTGCTGCGATT GTTTCTCCCATTAAGGAAATCGGCTGGAAAGGCGAACAAATTAATATTCCGTTGTTGCCC GGCGAACAAACCGGTCCATTGGCCAAAGAAGTTGCACAATGGATTAATGGAATCCAATAT GGCGAGACTGAGCATGGCAATTGGTCAAGGGTTGTTACTGATTTGAACTGA
Protein Properties
Pfam Domain Function
Protein Residues376
Protein Molecular Weight41624.39844
Protein Theoretical pI7.36
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Branched-chain-amino-acid aminotransferase, cytosolic MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWGTPEIKPYQNL SLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKRMNKSAQRICLPTFDPEELIT LIGKLIQQDKCLVPEGKGYSLYIRPTLIGTTAGLGVSTPDRALLYVICCPVGPYYKTGFK AVRLEATDYATRAWPGGCGDKKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGT MNAFFVFKDSKTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKEVAQWINGIQY GETEHGNWSRVVTDLN
References
External Links
ResourceLink
Saccharomyces Genome Database BAT2
Uniprot IDP47176
Uniprot NameBCA2_YEAST
GenBank Gene IDZ49648
Genebank Protein ID1015897
General Reference
  • Kispal, G., Steiner, H., Court, D. A., Rolinski, B., Lill, R. (1996). "Mitochondrial and cytosolic branched-chain amino acid transaminases from yeast, homologs of the myc oncogene-regulated Eca39 protein." J Biol Chem 271:24458-24464.8798704
  • Eden, A., Simchen, G., Benvenisty, N. (1996). "Two yeast homologs of ECA39, a target for c-Myc regulation, code for cytosolic and mitochondrial branched-chain amino acid aminotransferases." J Biol Chem 271:20242-20245.8702755
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956