Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-3-phosphoglycerate dehydrogenase 2
Synonyms
  • 3-PGDH 2
Gene NameSER33
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Specific Function3-phospho-D-glycerate + NAD(+) = 3- phosphonooxypyruvate + NADH
Cellular LocationNot Available
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Methane metabolismec00680 Map00680
SMPDB Reactions
3-Phosphoglyceric acid + NADNADH + hydron + Phosphohydroxypyruvic acid
KEGG Reactions
NAD + 3-phospho-D-glyceric acidNADH + Phosphohydroxypyruvic acid + hydron
Metabolites
YMDB IDNameView
YMDB000592-hydroxyglutaric acidShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB003413-Phosphoglyceric acidShow
YMDB00393Phosphohydroxypyruvic acidShow
YMDB00412NAD(+)Show
YMDB007563-phospho-D-glyceric acidShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
binding
nucleotide binding
oxidoreductase activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
NAD or NADH binding
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL074C
Gene Sequence>1410 bp ATGTCTTATTCAGCTGCCGATAATTTACAAGATTCATTCCAACGTGCCATGAACTTTTCT GGCTCTCCTGGTGCAGTCTCAACCTCACCAACTCAGTCATTTATGAACACACTACCTCGT CGTGTAAGCATTACAAAGCAACCAAAGGCTTTAAAACCTTTTTCTACTGGTGACATGAAT ATTCTACTGTTGGAAAATGTCAATGCAACTGCAATCAAAATCTTCAAGGATCAGGGTTAC CAAGTAGAGTTCCACAAGTCTTCTCTACCTGAGGATGAATTGATTGAAAAAATCAAAGAC GTACACGCTATCGGTATAAGATCCAAAACTAGATTGACTGAAAAAATACTACAGCATGCC AGGAATCTAGTTTGTATTGGTTGTTTTTGCATAGGTACCAATCAAGTAGACCTAAAATAT GCCGCTAGTAAAGGTATTGCTGTTTTCAATTCGCCATTCTCCAATTCAAGATCCGTAGCA GAATTGGTAATTGGTGAGATCATTAGTTTAGCAAGACAATTAGGTGATAGATCCATTGAA CTGCATACAGGTACATGGAATAAAGTCGCTGCTAGGTGTTGGGAAGTAAGAGGAAAAACT CTCGGTATTATTGGGTATGGTCACATTGGTTCGCAATTATCAGTTCTTGCAGAAGCTATG GGCCTGCATGTGCTATACTATGATATCGTGACAATTATGGCCTTAGGTACTGCCAGACAA GTTTCTACATTAGATGAATTGTTGAATAAATCTGATTTTGTAACACTACATGTACCAGCT ACTCCAGAAACTGAAAAAATGTTATCTGCTCCACAATTCGCTGCTATGAAGGACGGGGCT TATGTTATTAATGCCTCAAGAGGTACTGTCGTGGACATTCCATCTCTGATCCAAGCCGTC AAGGCCAACAAAATTGCAGGTGCTGCTTTAGATGTTTATCCACATGAACCAGCTAAGAAC GGTGAAGGTTCATTTAACGATGAACTTAACAGCTGGACTTCTGAGTTGGTTTCATTACCA AATATAATCCTGACACCACATATTGGTGGCTCTACAGAAGAAGCTCAAAGTTCAATCGGT ATTGAGGTGGCTACTGCATTGTCCAAATACATCAATGAAGGTAACTCTGTCGGTTCTGTG AACTTCCCAGAAGTCAGTTTGAAGTCTTTGGACTACGATCAAGAGAACACAGTACGTGTC TTGTATATTCATCGTAACGTTCCTGGTGTTTTGAAGACCGTTAATGATATCTTATCCGAT CATAATATCGAGAAACAGTTTTCTGATTCTCACGGCGAGATCGCTTATCTAATGGCAGAC ATCTCTTCTGTTAATCAAAGTGAAATCAAGGATATATATGAAAAGTTGAACCAAACTTCT GCCAAAGTTTCCATCAGGTTATTATACTAA
Protein Properties
Pfam Domain Function
Protein Residues469
Protein Molecular Weight51187.80078
Protein Theoretical pI6.38
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-3-phosphoglycerate dehydrogenase 2 MSYSAADNLQDSFQRAMNFSGSPGAVSTSPTQSFMNTLPRRVSITKQPKALKPFSTGDMN ILLLENVNATAIKIFKDQGYQVEFHKSSLPEDELIEKIKDVHAIGIRSKTRLTEKILQHA RNLVCIGCFCIGTNQVDLKYAASKGIAVFNSPFSNSRSVAELVIGEIISLARQLGDRSIE LHTGTWNKVAARCWEVRGKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTARQ VSTLDELLNKSDFVTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAV KANKIAGAALDVYPHEPAKNGEGSFNDELNSWTSELVSLPNIILTPHIGGSTEEAQSSIG IEVATALSKYINEGNSVGSVNFPEVSLKSLDYDQENTVRVLYIHRNVPGVLKTVNDILSD HNIEKQFSDSHGEIAYLMADISSVNQSEIKDIYEKLNQTSAKVSIRLLY
References
External Links
ResourceLink
Saccharomyces Genome Database SER33
Uniprot IDP40510
Uniprot NameSER33_YEAST
GenBank Gene IDZ37997
Genebank Protein ID556873
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956