You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-3-phosphoglycerate dehydrogenase 1
Synonyms
  • 3-PGDH 1
Gene NameSER3
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Specific Function3-phospho-D-glycerate + NAD(+) = 3- phosphonooxypyruvate + NADH
Cellular LocationNot Available
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Methane metabolismec00680 Map00680
SMPDB Reactions
3-Phosphoglyceric acid + NADNADH + hydron + Phosphohydroxypyruvic acid
KEGG Reactions
NAD + 3-phospho-D-glyceric acidNADH + Phosphohydroxypyruvic acid + hydron
Metabolites
YMDB IDNameView
YMDB000592-hydroxyglutaric acidShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB003413-Phosphoglyceric acidShow
YMDB00393Phosphohydroxypyruvic acidShow
YMDB00412NAD(+)Show
YMDB007563-phospho-D-glyceric acidShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
NAD or NADH binding
catalytic activity
binding
nucleotide binding
oxidoreductase activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER081W
Gene Sequence>YER081W Chr 5 ATGACAAGCATTGACATTAACAACTTACAAAATACCTTTCAACAAGCTATGAATATGAGC GGCTCCCCAGGCGCTGTTTGTACTTCACCTACGCAATCTTTCATGAATACCGTTCCACAG CGCTTGAATGCTGTAAAGCACCCAAAAATTTTGAAGCCTTTCTCAACGGGTGATATGAAG ATTTTACTATTAGAAAACGTTAATCAAACTGCTATTACAATCTTCGAAGAGCAAGGTTAC CAAGTCGAATTCTATAAATCTTCATTGCCCGAGGAAGAGTTGATCGAAAAGATCAAGGAC GTTCATGCTATTGGTATCAGATCAAAGACTAGATTAACTTCAAATGTCTTACAACATGCG AAGAATCTGGTTTGTATTGGTTGTTTCTGTATCGGTACCAACCAAGTTGACTTAGACTAC GCTACCAGCAGAGGTATTGCTGTTTTCAACTCGCCTTTCTCCAACTCAAGATCAGTAGCA GAATTGGTCATCGCTGAAATCATTAGTTTAGCAAGACAACTAGGTGATAGATCTATCGAA TTACATACCGGTACATGGAATAAGGTTGCTGCTAGATGTTGGGAGGTAAGAGGAAAAACT CTTGGTATTATTGGGTACGGTCACATTGGTTCCCAATTATCAGTTCTTGCAGAAGCTATG GGTTTGCATGTGTTGTACTACGATATTGTAACTATCATGGCCTTGGGTACTGCCAGACAA GTTTCTACATTAGATGAATTGTTGAATAAATCTGATTTTGTGACACTACATGTACCAGCT ACTCCTGAAACTGAAAAAATGTTATCTGCCCCACAATTTGCTGCTATGAAGGATGGCGCT TATGTTATTAATGCTTCAAGAGGTACTGTCGTGGACATTCCATCTTTGATCCAAGCCGTG AAAGCCAACAAAATTGCAGGTGCTGCTTTGGATGTTTATCCACATGAACCAGCTAAGAAC GGTGAAGGTTCATTTAACGATGAGCTAAATAGCTGGACTTCTGAATTAGTTTCATTACCA AATATCATCTTGACACCACACATTGGTGGCTCTACCGAAGAAGCCCAAAGCTCAATCGGT ATTGAAGTGGCTACCGCATTGTCCAAATACATCAATGAAGGTAACTCTGTCGGTTCAGTC AACTTCCCAGAAGTGGCATTGAAATCATTGTCTTACGACCAAGAGAACACTGTGCGTGTG TTATACATTCACCAAAATGTACCAGGTGTTTTGAAGACCGTCAATGATATTTTATCGAAC CATAACATCGAAAAGCAATTTTCCGATTCAAATGGTGAAATTGCTTATTTAATGGCTGAT ATCTCTTCTGTTGACCAAAGCGATATTAAAGATATTTATGAACAACTAAATCAAACCTCT GCTAAGATCTCAATTAGATTGCTATATTAA
Protein Properties
Pfam Domain Function
Protein Residues469
Protein Molecular Weight51192.80078
Protein Theoretical pI5.28
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-3-phosphoglycerate dehydrogenase 1 MTSIDINNLQNTFQQAMNMSGSPGAVCTSPTQSFMNTVPQRLNAVKHPKILKPFSTGDMK ILLLENVNQTAITIFEEQGYQVEFYKSSLPEEELIEKIKDVHAIGIRSKTRLTSNVLQHA KNLVCIGCFCIGTNQVDLDYATSRGIAVFNSPFSNSRSVAELVIAEIISLARQLGDRSIE LHTGTWNKVAARCWEVRGKTLGIIGYGHIGSQLSVLAEAMGLHVLYYDIVTIMALGTARQ VSTLDELLNKSDFVTLHVPATPETEKMLSAPQFAAMKDGAYVINASRGTVVDIPSLIQAV KANKIAGAALDVYPHEPAKNGEGSFNDELNSWTSELVSLPNIILTPHIGGSTEEAQSSIG IEVATALSKYINEGNSVGSVNFPEVALKSLSYDQENTVRVLYIHQNVPGVLKTVNDILSN HNIEKQFSDSNGEIAYLMADISSVDQSDIKDIYEQLNQTSAKISIRLLY
References
External Links
ResourceLink
Saccharomyces Genome Database SER3
Uniprot IDP40054
Uniprot NameSERA_YEAST
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956