Identification
Name: Branched-chain-amino-acid aminotransferase, mitochondrial
Synonyms
  • BCAT
  • Protein ECA39
  • Protein TWT1
Gene Name: BAT1 Link_out
Enzyme Class:
Biological Properties
General Function: Involved in catalytic activity
Specific Function: Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. Appears to be involved in the regulation of the transition from G1 to S phase in the cell cycle. High copy suppressor of a temperature-sensitive mutation in the ABC transporter, ATM1
Cellular Location: Mitochondrion matrix
Pathways:
  • Valine, leucine and isoleucine degradation 00280 Link_out
  • Valine, leucine and isoleucine biosynthesis 00290 Link_out
  • Pantothenate and CoA biosynthesis 00770 Link_out
  • Reactions:
    • L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate.
    • 2-oxoglutaric acid + L-isoleucine = (S)-3-methyl-2-oxopentanoic acid + L-glutamic acid.
    • 2-oxoglutaric acid + L-valine = 3-methyl-2-oxobutanoic acid + L-glutamic acid.
    Metabolites:
    YMDB ID Name View
    YMDB00038L-Isoleucine
    YMDB00152L-Valine
    YMDB00153Oxoglutaric acid
    YMDB00168(S)-3-methyl-2-oxovaleric acid
    YMDB00271L-Glutamic acid
    YMDB00365Alpha-Ketoisovaleric acid
    YMDB00387L-Leucine
    YMDB00388Ketoleucine
    YMDB00449(2S)-2-Isopropyl-3-oxosuccinate
    YMDB00862hydron
    YMDB00912Carbon dioxide
    GO Classification:
    Component
    Not Available
    Function
    transferase activity, transferring nitrogenous groups
    transaminase activity
    branched-chain-amino-acid transaminase activity
    catalytic activity
    transferase activity
    Process
    cellular metabolic process
    cellular amino acid and derivative metabolic process
    cellular amino acid metabolic process
    branched chain family amino acid metabolic process
    metabolic process
    Gene Properties
    Chromosome Location: chromosome 8
    Locus: YHR208W Link_out
    Gene Sequence:
    >1182 bp
    ATGTTGCAGAGACATTCCTTGAAGTTGGGGAAATTCTCCATCAGAACACTCGCTACTGGT
    GCCCCATTAGATGCATCCAAACTAAAAATTACTAGAAACCCAAATCCATCCAAGCCAAGA
    CCAAATGAAGAATTAGTGTTCGGCCAGACATTCACCGATCATATGTTGACCATTCCTTGG
    TCAGCCAAAGAAGGGTGGGGCACTCCACACATCAAGCCTTACGGTAATCTTTCTCTTGAC
    CCATCTGCTTGTGTATTCCATTATGCATTTGAATTATTTGAAGGTTTGAAAGCCTACAGA
    ACTCCTCAAAATACTATCACCATGTTCCGTCCGGATAAGAACATGGCCCGTATGAACAAG
    TCTGCCGCTAGAATTTGTTTGCCAACTTTCGAATCTGAAGAATTGATCAAACTTACCGGG
    AAATTGATCGAACAAGATAAACACTTGGTTCCTCAAGGTAATGGTTACTCATTATACATC
    AGACCAACAATGATTGGTACATCCAAGGGTTTAGGTGTTGGCACTCCCTCCGAGGCTCTT
    CTTTATGTTATTACTTCTCCAGTCGGTCCTTATTATAAGACTGGTTTCAAAGCCGTACGT
    CTTGAAGCAACAGACTATGCTACAAGAGCTTGGCCAGGTGGTGTTGGCGACAAAAAATTG
    GGTGCTAACTATGCCCCATGCATCTTACCTCAACTACAAGCTGCCAAAAGAGGGTACCAA
    CAAAATCTATGGTTGTTCGGCCCAGAAAAGAACATCACTGAGGTTGGTACTATGAACGTG
    TTCTTCGTTTTCCTCAACAAAGTCACTGGCAAGAAGGAATTGGTTACCGCTCCATTAGAT
    GGTACCATTTTAGAAGGTGTTACCAGAGACTCTGTTTTAACATTGGCTCGTGACAAACTA
    GATCCTCAAGAATGGGACATCAACGAGCGTTATTACACTATTACTGAAGTCGCCACTAGA
    GCAAAACAAGGTGAACTATTAGAAGCCTTCGGTTCTGGTACTGCTGCTGTCGTTTCACCT
    ATCAAGGAAATTGGCTGGAACAACGAAGATATTCATGTTCCACTATTGCCTGGTGAACAA
    TGTGGTGCATTGACCAAGCAAGTTGCTCAATGGATTGCTGATATCCAATACGGTAGAGTC
    AATTATGGTAACTGGTCAAAAACTGTTGCCGACTTGAACTAA
    Protein Properties
    Pfam Domain Function:
    Protein Residues: 393
    Protein Molecular Weight: 43595.69922
    Protein Theoretical pI: 9.27
    Signalling Regions:
    • None
    Transmembrane Regions:
    • None
    Protein Sequence:
    >Branched-chain-amino-acid aminotransferase, mitochondrial
    MLQRHSLKLGKFSIRTLATGAPLDASKLKITRNPNPSKPRPNEELVFGQTFTDHMLTIPW
    SAKEGWGTPHIKPYGNLSLDPSACVFHYAFELFEGLKAYRTPQNTITMFRPDKNMARMNK
    SAARICLPTFESEELIKLTGKLIEQDKHLVPQGNGYSLYIRPTMIGTSKGLGVGTPSEAL
    LYVITSPVGPYYKTGFKAVRLEATDYATRAWPGGVGDKKLGANYAPCILPQLQAAKRGYQ
    QNLWLFGPEKNITEVGTMNVFFVFLNKVTGKKELVTAPLDGTILEGVTRDSVLTLARDKL
    DPQEWDINERYYTITEVATRAKQGELLEAFGSGTAAVVSPIKEIGWNNEDIHVPLLPGEQ
    CGALTKQVAQWIADIQYGRVNYGNWSKTVADLN
    References
    External Links:
    Resource Link
    Saccharomyces Genome Database: BAT1 Link_out
    Uniprot ID: P38891 Link_out
    Uniprot Name: BCA1_YEAST Link_out
    GenBank Gene ID: AY558111 Link_out
    Genebank Protein ID: 45270112 Link_out
    General Reference:
    • Kispal, G., Steiner, H., Court, D. A., Rolinski, B., Lill, R. (1996). "Mitochondrial and cytosolic branched-chain amino acid transaminases from yeast, homologs of the myc oncogene-regulated Eca39 protein." J Biol Chem 271:24458-24464. Pubmed: 8798704 Link_out
    • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082. Pubmed: 8091229 Link_out
    • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543. Pubmed: 17322287 Link_out
    • Eden, A., Simchen, G., Benvenisty, N. (1996). "Two yeast homologs of ECA39, a target for c-Myc regulation, code for cytosolic and mitochondrial branched-chain amino acid aminotransferases." J Biol Chem 271:20242-20245. Pubmed: 8702755 Link_out
    • Ben-Yosef, T., Yanuka, O., Benvenisty, N. (1996). "ECA39 is regulated by c-Myc in human and by a Jun/Fos homolog, Gcn4, in yeast." Oncogene 13:1859-1866. Pubmed: 8934531 Link_out
    • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741. Pubmed: 14562106 Link_out
    • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396. Pubmed: 18407956 Link_out