You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADPH-dependent aldose reductase GRE3
Synonyms
  • Genes de respuesta a estres protein 3
  • NADPH-dependent aldo-keto reductase GRE3
  • NADPH-dependent methylglyoxal reductase GRE3
  • Xylose reductase
Gene NameGRE3
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionReduces the cytotoxic compound methylglyoxal (MG) to (R)-lactaldehyde similar to GRE2. MG is synthesized via a bypath of glycolysis from dihydroxyacetone phosphate and is believed to play a role in cell cycle regulation and stress adaptation. In pentose-fermenting yeasts, aldose reductase catalyzes the reduction of xylose into xylitol. The purified enzyme catalyzes this reaction, but the inability of S.cerevisiae to grow on xylose as sole carbon source indicates that the physiological function is more likely methylglyoxal reduction
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
xylitol degradationPW002433 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
Galactose metabolismec00052 Map00052
Glycerolipid metabolismec00561 Map00561
Pentose and glucuronate interconversionsec00040 Map00040
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
aldehydo-D-Xylose + NADPD-Xylitol + NADPH + hydron
KEGG Reactions
D-glyceraldehyde + NADPH + hydronNADP + Glycerol
L-Arabinose + NADPH + hydronNADP + L-arabinitol
D-Glucose + NADPH + hydronNADP + D-glucitol
Pyruvaldehyde + NADPH + hydronNADP + Lactaldehyde
aldehydo-D-Xylose + NADPH + hydronNADP + Xylitol
Metabolites
YMDB IDNameView
YMDB00111D-LactaldehydeShow
YMDB00167LactaldehydeShow
YMDB00170PyruvaldehydeShow
YMDB00283GlycerolShow
YMDB00286D-GlucoseShow
YMDB00373D-XylitolShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00575D-glyceraldehydeShow
YMDB00591L-arabinitolShow
YMDB00656D-glucitolShow
YMDB00778XylitolShow
YMDB00779aldehydo-D-XyloseShow
YMDB00862hydronShow
YMDB00893L-ArabinoseShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR104W
Gene Sequence>984 bp ATGTCTTCACTGGTTACTCTTAATAACGGTCTGAAAATGCCCCTAGTCGGCTTAGGGTGC TGGAAAATTGACAAAAAAGTCTGTGCGAATCAAATTTATGAAGCTATCAAATTAGGCTAC CGTTTATTCGATGGTGCTTGCGACTACGGCAACGAAAAGGAAGTTGGTGAAGGTATCAGG AAAGCCATCTCCGAAGGTCTTGTTTCTAGAAAGGATATATTTGTTGTTTCAAAGTTATGG AACAATTTTCACCATCCTGATCATGTAAAATTAGCTTTAAAGAAGACCTTAAGCGATATG GGACTTGATTATTTAGACCTGTATTATATTCACTTCCCAATCGCCTTCAAATATGTTCCA TTTGAAGAGAAATACCCTCCAGGATTCTATACGGGCGCAGATGACGAGAAGAAAGGTCAC ATCACCGAAGCACATGTACCAATCATAGATACGTACCGGGCTCTGGAAGAATGTGTTGAT GAAGGCTTGATTAAGTCTATTGGTGTTTCCAACTTTCAGGGAAGCTTGATTCAAGATTTA TTACGTGGTTGTAGAATCAAGCCCGTGGCTTTGCAAATTGAACACCATCCTTATTTGACT CAAGAACACCTAGTTGAGTTTTGTAAATTACACGATATCCAAGTAGTTGCTTACTCCTCC TTCGGTCCTCAATCATTCATTGAGATGGACTTACAGTTGGCAAAAACCACGCCAACTCTG TTCGAGAATGATGTAATCAAGAAGGTCTCACAAAACCATCCAGGCAGTACCACTTCCCAA GTATTGCTTAGATGGGCAACTCAGAGAGGCATTGCCGTCATTCCAAAATCTTCCAAGAAG GAAAGGTTACTTGGCAACCTAGAAATCGAAAAAAAGTTCACTTTAACGGAGCAAGAATTG AAGGATATTTCTGCACTAAATGCCAACATCAGATTTAATGATCCATGGACCTGGTTGGAT GGTAAATTCCCCACTTTTGCCTGA
Protein Properties
Pfam Domain Function
Protein Residues327
Protein Molecular Weight37118.5
Protein Theoretical pI7.09
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADPH-dependent aldose reductase GRE3 MSSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIR KAISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVP FEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDL LRGCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTL FENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQEL KDISALNANIRFNDPWTWLDGKFPTFA
References
External Links
ResourceLink
Saccharomyces Genome Database GRE3
Uniprot IDP38715
Uniprot NameGRE3_YEAST
GenBank Gene IDU00059
Genebank Protein ID529125
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Garay-Arroyo, A., Covarrubias, A. A. (1999). "Three genes whose expression is induced by stress in Saccharomyces cerevisiae." Yeast 15:879-892.10407268
  • Aguilera, J., Prieto, J. A. (2001). "The Saccharomyces cerevisiae aldose reductase is implied in the metabolism of methylglyoxal in response to stress conditions." Curr Genet 39:273-283.11525399
  • Traff, K. L., Otero Cordero, R. R., van Zyl, W. H., Hahn-Hagerdal, B. (2001). "Deletion of the GRE3 aldose reductase gene and its influence on xylose metabolism in recombinant strains of Saccharomyces cerevisiae expressing the xylA and XKS1 genes." Appl Environ Microbiol 67:5668-5674.11722921
  • Lee, H. (1998). "The structure and function of yeast xylose (aldose) reductases." Yeast 14:977-984.9730277
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956