You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFumarate reductase
Synonyms
  • FAD-dependent oxidoreductase FRDS
  • NADH
  • NADH-dependent fumarate reductase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in electron carrier activity
Specific FunctionCould be a fumarate reductase
Cellular LocationMitochondrion. Cytoplasm
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
Succinic acid + Coenzyme Q10 + FADFumaric acid + QH2 + FADH2
KEGG Reactions
Fumaric acid + FADH2FAD + Succinic acid
Fumaric acid + FMNH2Flavin Mononucleotide + Succinic acid
Metabolites
YMDB IDNameView
YMDB00085Flavin MononucleotideShow
YMDB00101Fumaric acidShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00296FADShow
YMDB00338Succinic acidShow
YMDB00412NAD(+)Show
YMDB00597FADH2Show
YMDB00686FMNH2Show
YMDB16129Coenzyme Q10Show
GO Classification
Component
Not Available
Function
catalytic activity
oxidoreductase activity
electron carrier activity
oxidoreductase activity, acting on the CH-CH group of donors
succinate dehydrogenase activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome LocationNot Available
LocusYEL047C
Gene Sequence>1413 bp ATGTCTCTCTCTCCCGTTGTTGTTATTGGAACCGGTTTGGCCGGGCTGGCTGCTGCCAAT GAATTGGTTAACAAGTATAACATCCCTGTAACCATCCTCGAAAAGGCTTCCTCGATCGGT GGGAACTCTATCAAGGCCTCCAGTGGTATTAACGGTGCTTGCACCGAGACTCAACGTCAC TTCCACATCGAGGACTCCCCACGCTTATTTGAAGATGACACCATCAAGTCTGCTAAAGGT AAAGGTGTCCAAGAATTAATGGCTAAGTTGGCCAATGATTCTCCCCTGGCTATTGAATGG TTGAAAAACGAATTTGATTTGAAATTGGACCTATTGGCTCAATTGGGTGGCCACTCTGTG GCAAGAACTCACAGATCGTCTGGGAAGTTGCCTCCAGGTTTCGAAATTGTTTCTGCCTTA TCTAACAATTTGAAGAAATTAGCTGAGACTAAACCAGAGTTAGTTAAGATTAACTTAGAC AGTAAAGTCGTAGACATCCATGAAAAGGATGGCTCCATTTCTGCTGTAGTGTACGAGGAC AAGAATGGCGAAAAGCACATGGTGAGTGCTAACGATGTCGTTTTTTGTTCTGGAGGGTTT GGCTTTTCTAAGGAAATGCTTAAAGAATACGCACCCGAACTGGTGAACTTGCCAACAACA AACGGGCAACAAACAACTGGTGATGGTCAAAGGCTTCTGCAGAAGTTAGGCGCTGATCTG ATTGACATGGACCAAATTCAAGTTCATCCAACTGGGTTCATTGATCCAAATGACCGTAGC TCAAGCTGGAAATTCTTGGCTGCCGAATCCTTAAGAGGTCTTGGTGGTATCCTATTAAAC CCTATTACCGGTAGAAGATTTGTCAACGAATTGACCACAAGAGATGTAGTCACTGCAGCT ATTCAAAAGGTTTGTCCTCAAGAGGATAACAGAGCACTATTGGTTATGGGCGAAAAAATG TACACAGATTTGAAGAATAATTTAGATTTTTACATGTTCAAGAAACTTGTACAGAAATTG ACATTATCTCAAGTTGTTTCTGAATATAATTTACCAATCACTGTCGCCCAATTATGCGAG GAATTGCAAACATACTCTTCCTTCACTACCAAGGCTGATCCGTTGGGACGTACCGTTATT CTCAACGAATTTGGCTCTGACGTTACTCCAGAAACTGTGGTTTTTATTGGTGAAGTAACA CCGGTTGTCCATTTCACCATGGGTGGTGCTAGAATCAATGTCAAGGCTCAAGTCATTGGC AAGAACGACGAAAGGCTACTAAAAGGCCTGTACGCGGCCGGTGAAGTTTCTGGCGGTGTT CATGGCGCCAATAGGTTGGGTGGTTCAAGTTTGTTAGAATGCGTTGTCTTTGGGAGAACC GCAGCTGAATCTATTGCCAATGACCGCAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues470
Protein Molecular Weight50843.69922
Protein Theoretical pI6.26
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fumarate reductase MSLSPVVVIGTGLAGLAAANELVNKYNIPVTILEKASSIGGNSIKASSGINGACTETQRH FHIEDSPRLFEDDTIKSAKGKGVQELMAKLANDSPLAIEWLKNEFDLKLDLLAQLGGHSV ARTHRSSGKLPPGFEIVSALSNNLKKLAETKPELVKINLDSKVVDIHEKDGSISAVVYED KNGEKHMVSANDVVFCSGGFGFSKEMLKEYAPELVNLPTTNGQQTTGDGQRLLQKLGADL IDMDQIQVHPTGFIDPNDRSSSWKFLAAESLRGLGGILLNPITGRRFVNELTTRDVVTAA IQKVCPQEDNRALLVMGEKMYTDLKNNLDFYMFKKLVQKLTLSQVVSEYNLPITVAQLCE ELQTYSSFTTKADPLGRTVILNEFGSDVTPETVVFIGEVTPVVHFTMGGARINVKAQVIG KNDERLLKGLYAAGEVSGGVHGANRLGGSSLLECVVFGRTAAESIANDRK
References
External Links
ResourceLink
Saccharomyces Genome Database YEL047C
Uniprot IDP32614
Uniprot NameFRDS_YEAST
GenBank Gene IDU18779
Genebank Protein ID603632
General Reference
  • Enomoto, K., Ohki, R., Muratsubaki, H. (1996). "Cloning and sequencing of the gene encoding the soluble fumarate reductase from Saccharomyces cerevisiae." DNA Res 3:263-267.8946166
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950