You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcyl carrier protein, mitochondrial
Synonyms
  • ACP
  • NADH-ubiquinone oxidoreductase 9.6 kDa subunit
Gene NameACP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in acyl carrier activity
Specific FunctionCarrier of the growing fatty acid chain in fatty acid biosynthesis. May be involved in the synthesis of very-long-chain fatty acids. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00533malonyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
phosphopantetheine binding
binding
substrate-specific transporter activity
carboxylic acid binding
acyl carrier activity
amino acid binding
transporter activity
cofactor binding
Process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
cellular metabolic process
fatty acid biosynthetic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL192C
Gene Sequence>378 bp ATGTTTAGATCCGTTTGCCGCATTTCTTCCCGCGTGGCACCTTCTGCGTACCGCACTATA ATGGGCCGTTCCGTTATGTCCAACACCATACTCGCACAAAGATTTTATTCTGCAAACTTG AGCAAAGATCAGGTTTCTCAAAGGGTCATTGATGTTATCAAGGCGTTTGATAAGAACTCT CCCAACATTGCCAACAAGCAAATCTCCAGCGATACCCAATTTCACAAGGATTTGGGGTTG GACTCCTTGGACACTGTCGAGCTGCTCGTAGCTATTGAAGAAGAATTTGATATTGAAATC CCTGACAAAGTGGCTGATGAGTTGAGAAGTGTTGGTGAAACGGTCGATTATATCGCTTCC AATCCCGACGCAAACTAA
Protein Properties
Pfam Domain Function
Protein Residues125
Protein Molecular Weight13942.5
Protein Theoretical pI4.57
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Acyl carrier protein, mitochondrial MFRSVCRISSRVAPSAYRTIMGRSVMSNTILAQRFYSANLSKDQVSQRVIDVIKAFDKNS PNIANKQISSDTQFHKDLGLDSLDTVELLVAIEEEFDIEIPDKVADELRSVGETVDYIAS NPDAN
References
External Links
ResourceLink
Saccharomyces Genome Database ACP1
Uniprot IDP32463
Uniprot NameACPM_YEAST
GenBank Gene IDAY558392
Genebank Protein ID45270674
General Reference
  • Cheret, G., Mattheakis, L. C., Sor, F. (1993). "DNA sequence analysis of the YCN2 region of chromosome XI in Saccharomyces cerevisiae." Yeast 9:661-667.8394042
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106