You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRepressible alkaline phosphatase
SynonymsNot Available
Gene NamePHO8
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionA phosphate monoester + H(2)O = an alcohol + phosphate
Cellular LocationVacuole membrane; Single-pass membrane protein (Potential).
SMPDB PathwaysNot Available
KEGG Pathways
Folate biosynthesisec00790 Map00790
SMPDB ReactionsNot Available
KEGG Reactions
7,8-dihydroneopterin 3'-triphosphate + waterphosphate + 7,8-Dihydroneopterin + hydron
Metabolites
YMDB IDNameView
YMDB00011D-Fructose 2,6-bisphosphateShow
YMDB00219PyrophosphateShow
YMDB00229Farnesyl pyrophosphateShow
YMDB00404(2-trans,6-trans)-FarnesolShow
YMDB005787,8-dihydroneopterin 3'-triphosphateShow
YMDB005797,8-DihydroneopterinShow
YMDB00862hydronShow
YMDB00878D-fructofuranose 2-phosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR481C
Gene Sequence>1701 bp ATGATGACTCACAGATTACCAAGCGAACAGACACGTCTTGTTCCTGGATCTGACTCGAGC TCTCGTCCTAAAAAGAGACGGATCTCGAAGAGATCGAAGATAATAGTATCCACTGTGGTC TGTATTGGTTTGTTGCTGGTTTTAGTGCAACTGGCATTTCCAACCAGTTTTGCTATACGT TCTGCATCACACAAGAAGAAGAATGTCATATTCTTCGTGACGGATGGAATGGGACCTGCG TCTTTGTCCATGGCAAGATCATTCAACCAGCACGTTAATGATCTACCTATAGACGACATC CTGACACTTGACGAGCATTTTATCGGGTCTTCGAGAACAAGGTCCTCGGACTCACTAGTC ACTGACTCAGCTGCGGGCGCCACCGCATTTGCATCTGCATTAAAGAGCTATAATGGGGCC ATCGGCGTTGATCCGCATCACAGACCTTGTGGTACAGTGCTCGAGGCGGCTAAGTTAGCA GGTTATCTCACTGGGCTTGTTGTTACGACAAGAATCACAGATGCCACTCCGGCTTCATTC AGTTCACATGTTGATTACAGATGGCAGGAAGATCTTATTGCTACGCACCAGTTAGGCGAA TATCCTCTGGGGAGAGTAGTAGACTTACTCATGGGTGGCGGCAGGAGCCATTTCTACCCT CAAGGCGAAAAGGCTTCTCCATATGGTCACCACGGTGCTAGAAAAGATGGAAGAGATTTA ATCGATGAGGCTCAATCTAATGGCTGGCAGTACGTGGGTGACCGTAAAAATTTTGATTCT TTGTTGAAAAGCCACGGTGAAAACGTTACTTTTCCTTTCTTGGGTCTCTTTGCAGATAAC GACATTCCTTTTGAAATTGACAGAGATGAAAAGGAGTATCCTTCTCTTAAGGAACAAGTC AAGGTGGCTTTGGGTGCCTTGGAAAAAGCTTCCAATGAGGACAAAGATTCTAATGGGTTT TTCTTAATGGTGGAAGGCTCCAGAATTGACCACGCTGGTCACCAAAACGATCCAGCTTCA CAGGTAAGGGAGGTGTTGGCTTTCGATGAAGCATTCCAATACGTTTTGGAGTTTGCTGAA AATTCCGATACGGAGACTGTTTTGGTCTCTACGTCGGATCATGAAACGGGTGGTTTAGTC ACTTCAAGACAAGTCACTGCTAGCTATCCTCAGTATGTCTGGTATCCACAGGTGCTTGCC AACGCCACCCATTCAGGTGAGTTTTTGAAAAGAAAACTAGTAGATTTTGTTCATGAACAT AAGGGCGCAAGCAGCAAAATAGAAAATTTCATCAAACATGAGATCCTGGAAAAGGATTTG GGCATTTACGATTACACGGAAAGTGATTTAGAAACATTAATTCATTTGGATGACAACGCA AATGCTATCCAAGACAAACTGAATGACATGGTATCATTTAGGGCCCAAATTGGCTGGACC ACGCATGGTCACAGCGCAGTCGACGTCAACATATATGCATACGCCAATAAGAAAGCTACA TGGTCATATGTCTTGAACAATTTACAAGGCAATCACGAAAATACGGAAGTTGGCCAGTTC TTAGAAAACTTTTTAGAATTGAACCTGAACGAAGTCACTGATTTGATTAGGGACACCAAA CACACATCAGATTTTGATGCTACAGAAATAGCTAGTGAAGTACAACATTATGACGAATAC TACCATGAGTTGACCAACTGA
Protein Properties
Pfam Domain Function
Protein Residues566
Protein Molecular Weight63003.60156
Protein Theoretical pI5.33
Signalling Regions
  • None
Transmembrane Regions
  • 34-59
Protein Sequence>Repressible alkaline phosphatase MMTHTLPSEQTRLVPGSDSSSRPKKRRISKRSKIIVSTVVCIGLLLVLVQLAFPSSFALR SASHKKKNVIFFVTDGMGPASLSMARSFNQHVNDLPIDDILTLDEHFIGSSRTRSSDSLV TDSAAGATAFACALKSYNGAIGVDPHHRPCGTVLEAAKLAGYLTGLVVTTRITDATPASF SSHVDYRWQEDLIATHQLGEYPLGRVVDLLMGGGRSHFYPQGEKASPYGHHGARKDGRDL IDEAQSNGWQYVGDRKNFDSLLKSHGENVTLPFLGLFADNDIPFEIDRDEKEYPSLKEQV KVALGALEKASNEDKDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDEAFQYVLEFAE NSDTETVLVSTSDHETGGLVTSRQVTASYPQYVWYPQVLANATHSGEFLKRKLVDFVHEH KGASSKIENFIKHEILEKDLGIYDYTDSDLETLIHLDDNANAIQDKLNDMVSFRAQIGWT THGHSAVDVNIYAYANKKATWSYVLNNLQGNHENTEVGQFLENFLELNLNEVTDLIRDTK HTSDFDATEIASEVQHYDEYYHELTN
References
External Links
ResourceLink
Saccharomyces Genome Database PHO8
Uniprot IDP11491
Uniprot NamePPB_YEAST
GenBank Gene IDM21134
Genebank Protein ID172164
General Reference
  • Kaneko, Y., Hayashi, N., Toh-e, A., Banno, I., Oshima, Y. (1987). "Structural characteristics of the PHO8 gene encoding repressible alkaline phosphatase in Saccharomyces cerevisiae." Gene 58:137-148.3319783
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Klionsky, D. J., Emr, S. D. (1989). "Membrane protein sorting: biosynthesis, transport and processing of yeast vacuolar alkaline phosphatase." EMBO J 8:2241-2250.2676517
  • Plankert, U., Purwin, C., Holzer, H. (1991). "Yeast fructose-2,6-bisphosphate 6-phosphatase is encoded by PHO8, the gene for nonspecific repressible alkaline phosphatase." Eur J Biochem 196:191-196.1848184
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867