You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCarbamoyl-phosphate synthase arginine-specific small chain
Synonyms
  • CPS-A
  • Arginine-specific carbamoyl-phosphate synthetase, glutamine chain
Gene NameCPA1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific Function2 ATP + L-glutamine + HCO(3)(-) + H(2)O = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
Cellular LocationCytoplasm
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00082CarbamoylphosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB00382Carbonic acidShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
carbamoyl-phosphate synthase activity
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
Process
nitrogen compound metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
glutamine metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR303W
Gene Sequence>1236 bp ATGTCCTCCGCTGCAACAAAAGCTACTTTCTGTATTCAAAATGGTCCTTCCTTTGAAGGT ATATCTTTTGGTGCAAACAAATCTGTTGCTGGTGAAACAGTTTTCACTACTTCTCTGGTT GGTTACCCAGAGTCCATGACTGATCCTTCCTACCGTGGTCAGATATTAGTCTTCACGCAA CCCTTGATTGGTAACTACGGTGTCCCATCCGGCGAAGCCCGCGATGAATACAATTTACTG AAGTATTTTGAATCTCCGCATATACATGTGGTCGGCATCGTTGTCGCTGAATATGCTTAT CAATATTCGCATTGGACCGCTGTTGAATCTCTGGCACAATGGTGTCAGAGAGAAGGTGTT GCTGCTATTACTGGCGTAGACACCCGTGAACTAGTGCAATACTTGAGGGAACAAGGTTCT TCTTTGGGCCGTATTACGTTGGCTGATCATGACCCTGTCCCCTACGTGAATCCCATGAAA ACTAACTTGGTTGCTCAAGTCACCACAAAAAAGCCTTTCCACGTCTCTGCCTTACCTGGG AAGGCTAAGGCAAATGTGGCTCTTATTGACTGTGGTGTTAAAGAAAACATTATCAGATGC CTAGTCAAAAGAGGTGCCAATGTAACTGTTTTCCCCTATGATTACAGAATTCAAGATGTT GCTTCTGAATTCGACGGTATTTTCTTATCCAATGGACCAGGCAACCCAGAACTATGCCAA GCTACAATTTCCAACGTCAGGGAATTACTAAATAACCCTGTTTATGACTGTATCCCTATT TTTGGGATTTGTCTAGGCCATCAACTCTTGGCTCTGGCCTCCGGTGCCTCTACTCACAAA TTGAAATATGGTAATAGGGCTCACAACATCCCTGCCATGGATTTGACTACCGGCCAGTGC CACATTACATCTCAAAATCATGGCTATGCAGTTGATCCTGAGACCCTACCAAAGGACCAA TGGAAACCTTATTTTGTTAATTTAAACGACAAATCAAACGAAGGCATGATACACCTTCAA AGACCCATATTTTCTACCCAATTTCACCCAGAGGCAAAAGGTGGTCCCTTAGACACAGCT ATTCTTTTTGACAAATTCTTCGATAATATAGAAAAATACCAATTACAATCTCAGGCAAAA AGTTCAATCTCACTAAAAGTAACATACAGTACCGATAAATCGAGATTGCAGAGTATAAAT GTTACTAAGTTGGCCAAGGAAAGAGTGTTGTTCTAA
Protein Properties
Pfam Domain Function
Protein Residues411
Protein Molecular Weight45361.19922
Protein Theoretical pI7.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Carbamoyl-phosphate synthase arginine-specific small chain MSSAATKATFCIQNGPSFEGISFGANKSVAGETVFTTSLVGYPESMTDPSYRGQILVFTQ PLIGNYGVPSGEARDEYNLLKYFESPHIHVVGIVVAEYAYQYSHWTAVESLAQWCQREGV AAITGVDTRELVQYLREQGSSLGRITLADHDPVPYVNPMKTNLVAQVTTKKPFHVSALPG KAKANVALIDCGVKENIIRCLVKRGANVTVFPYDYRIQDVASEFDGIFLSNGPGNPELCQ ATISNVRELLNNPVYDCIPIFGICLGHQLLALASGASTHKLKYGNRAHNIPAMDLTTGQC HITSQNHGYAVDPETLPKDQWKPYFVNLNDKSNEGMIHLQRPIFSTQFHPEAKGGPLDTA ILFDKFFDNIEKYQLQSQAKSSISLKVTYSTDKSRLQSINVTKLAKERVLF
References
External Links
ResourceLink
Saccharomyces Genome Database CPA1
Uniprot IDP07258
Uniprot NameCARA_YEAST
GenBank Gene IDK02132
Genebank Protein ID171305
General Reference
  • Werner, M., Feller, A., Pierard, A. (1985). "Nucleotide sequence of yeast gene CP A1 encoding the small subunit of arginine-pathway carbamoyl-phosphate synthetase. Homology of the deduced amino acid sequence to other glutamine amidotransferases." Eur J Biochem 146:371-381.3881260
  • Nyunoya, H., Lusty, C. J. (1984). "Sequence of the small subunit of yeast carbamyl phosphate synthetase and identification of its catalytic domain." J Biol Chem 259:9790-9798.6086650
  • Poirey, R., Cziepluch, C., Tobiasch, E., Pujol, A., Kordes, E., Jauniaux, J. C. (1997). "Sequence and analysis of a 36.2 kb fragment from the right arm of yeast chromosome XV reveals 19 open reading frames including SNF2 (5' end), CPA1, SLY41, a putative transport ATPase, a putative ribosomal protein and an SNF2 homologue." Yeast 13:479-482.9153758
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Werner, M., Feller, A., Messenguy, F., Pierard, A. (1987). "The leader peptide of yeast gene CPA1 is essential for the translational repression of its expression." Cell 49:805-813.3555844
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106