You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDeoxycytidylate deaminase
Synonyms
  • dCMP deaminase
Gene NameDCD1
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionSupplies the nucleotide substrate for thymidylate synthetase
Cellular LocationCytoplasmic
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
water + hydron + dCMPdUMP + Ammonium
water + hydron + dCTPDeoxyuridine triphosphate + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00201Deoxyuridine triphosphateShow
YMDB00206dCMPShow
YMDB00221dUMPShow
YMDB00423AmmoniumShow
YMDB00658dCTPShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
cation binding
metal ion binding
transition metal ion binding
zinc ion binding
hydrolase activity
catalytic activity
binding
ion binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 8
LocusYHR144C
Gene Sequence>939 bp ATGTTAATTGGTGTAAGTGGTACGAAATTTTGCGGATGCGAAGATGTTATTAACATGTTG GTTGATCATTTTCATTTTGAATTACTCAATCACCTAGATAATCCAGAGGAGATATTAGAT TATGCTACGAAAAATTACACAAAAAATTCAGTTATATTCCTAGAAAAATTATCATTACTG GAGAAACTGGAAAAGAGACCATTTTTTGTTCATCTTTCTATCGACGCTCCTGCTACTACA AGGGTAGCATTATACAGGAAAACGACTCAAGCAGAAAGCTTATCATTAGAACAAATAATA CAAGCCATTGATCAACATGACTTTCAGCCTGAAGGCATCAAATTAAGGGAGAAATCCCAT TTGAGATTTAAAATAGTTAATGAGGACCGCAGAGGAAGGAGACAGAGCTTGATTAATAAC ATTACCACACAATTAAAGATTCTCGATGACAAAGAGAAACAAATGGCTCCATTAATGAGG CCTAGTTGGGATAGCTATTTTATGAAGTTAGCCACACTAGCAGCATCTCGTTCCAATTGC ATGAAACGTAGAGTTGGTTGCGTGATTGTGAGAGAATGCAGAGTGATTGCTACTGGCTAT AATGGGACTCCTCGACATTTAACAAATTGTTTCAATGGCGGTTGCCCACGTTGCAATGAC GGTGATTCTAGAAATCTGCACACTTGCTTATGCTTACATGCAGAAGAGAATGCACTACTG GAAGCTGGCAGGGATCGTGTAGGTCAAAATGCGACCTTATACTGTGATACTTGCCCTTGC TTAACATGTTCTGTAAAGATTGTTCAAACAGGCATCAGTGAAGTAGTTTATAGCCAAAGT TATAGAATGGACGAGGAAAGTTTCAAGGTCTTGAAGAATGCGGGAATAACCGTCCGGCAA TTCAGCTTTACGGAAGAACCAAGAATTGTGATGATTTAA
Protein Properties
Pfam Domain Function
Protein Residues312
Protein Molecular Weight35645.69922
Protein Theoretical pI7.95
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Deoxycytidylate deaminase MLIGVSGTKFCGCEDVINMLVDHFHFELLNHLDNPEEILDYATKNYTKNSVIFLEKLSLL EKLEKRPFFVHLSIDAPVTTRVALYRKTTQAESLSLEQIIQAIDQHDFQPEGIKLREKSH LRFKIVNEDRRGRRQSLINNITTQLKILDDKEKQMAPLMRPSWDSYFMKLATLAASRSNC MKRRVGCVIVRECRVIATGYNGTPRHLTNCFNGGCPRCNDGDSRNLHTCLCLHAEENALL EAGRDRVGQNATLYCDTCPCLTCSVKIVQTGISEVVYSQSYRMDEESFKVLKNAGITVRQ FSFTEEPRIVMI
References
External Links
ResourceLink
Saccharomyces Genome Database DCD1
Uniprot IDP06773
Uniprot NameDCTD_YEAST
GenBank Gene IDM13010
Genebank Protein ID171384
General Reference
  • McIntosh, E. M., Haynes, R. H. (1986). "Sequence and expression of the dCMP deaminase gene (DCD1) of Saccharomyces cerevisiae." Mol Cell Biol 6:1711-1721.3023902
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106