You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexokinase-2
Synonyms
  • Hexokinase PII
  • Hexokinase-B
Gene NameHXK2
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionMain glucose phosphorylating enzyme. May play a regulatory role in both induction and repression of gene expression by glucose
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
Mannose MetabolismPW002391 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Fructose and mannose metabolismec00051 Map00051
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
D-Fructose + Adenosine triphosphateBeta-D-Fructose 6-phosphate + Adenosine triphosphate + hydron
D-Mannose + Adenosine triphosphatehydron + ADP + Mannose 6-phosphate
Adenosine triphosphate + D-FructoseADP + Beta-D-Fructose 6-phosphate
Adenosine triphosphate + D-MannoseADP + Mannose 6-phosphate
KEGG Reactions
Adenosine triphosphate + D-FructoseFructose 6-phosphate + hydron + ADP
Adenosine triphosphate + D-Glucosealdehydo-D-glucose 6-phosphate + hydron + ADP
Adenosine triphosphate + D-MannoseD-mannose 6-phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00072D-GalactoseShow
YMDB00078Fructose 6-phosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00242Mannose 6-phosphateShow
YMDB00286D-GlucoseShow
YMDB00582aldehydo-D-glucose 6-phosphateShow
YMDB00655D-fructose 1-phosphateShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
YMDB00914ADPShow
YMDB00947Glucose 6-phosphateShow
YMDB00966D-mannose 6-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
GO Classification
Component
Not Available
Function
adenyl ribonucleotide binding
ATP binding
phosphotransferase activity, alcohol group as acceptor
catalytic activity
transferase activity
hexokinase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL253W
Gene Sequence>1461 bp ATGGTTCATTTAGGTCCAAAAAAACCACAAGCCAGAAAGGGTTCCATGGCCGATGTGCCA AAGGAATTGATGCAACAAATTGAGAATTTTGAAAAAAATTTCACTGTTCCAACTGAAACT TTACAAGCCGTTACCAAGCATTTCATTTCCGAATTGGAAAAGGGTTTGTCCAAGAAGGGT GGTAACATTCCAATGATTCCAGGTTGGGTTATGGATTTCCCAACTGGTAAGGAATCCGGT GATTTCTTGGCCATTGATTTGGGTGGTACCAACTTGAGAGTTGTCTTAGTCAAGTTGGGC GGTGACCGTACCTTTGACACCACTCAATCTAAGTACAGATTACCAGATGCTATGAGAACT ACTCAAAATCCAGACGAATTGTGGGAATTTATTGCCGACTCTTTGAAAGCTTTTATTGAT GAGCAATTCCCACAAGGTATCTCTGAGCCAATTCCATTGGGTTTCACCTTTTCTTTCCCA GCTTCTCAAAACAAAATCAATGAAGGTATCTTGCAAAGATGGACTAAAGGTTTTGATATT CCAAACATTGAAAACCACGATGTTGTTCCAATGTTGCAAAAGCAAATCACCAAGAGGAAT ATCCCAATTGAAGTTGTTGCTTTGATAAACGACACTACCGGTACTTTGGTTGCTTCTTAC TACACTGACCCTGAAACTAAGATGGGTGTTATCTTCGGTACTGGTGTCAATGGTGCTTAC TACGATGTTTGTTCCGATATCGAAAAGCTACAAGGAAAACTATCTGATGACATTCCACCA TCTGCTCCAATGGCCATCAACTGTGAATACGGTTCCTTCGATAATGAACATGTCGTTTTG CCAAGAACTAAATACGATATCACCATTGATGAAGAATCTCCAAGACCAGGCCAACAAACC TTTGAAAAAATGTCTTCTGGTTACTACTTAGGTGAAATTTTGCGTTTGGCCTTGATGGAC ATGTACAAACAAGGTTTCATCTTCAAGAACCAAGACTTGTCTAAGTTCGACAAGCCTTTC GTCATGGACACTTCTTACCCAGCCAGAATCGAGGAAGATCCATTCGAGAACCTAGAAGAT ACCGATGACTTGTTCCAAAATGAGTTCGGTATCAACACTACTGTTCAAGAACGTAAATTG ATCAGACGTTTATCTGAATTGATTGGTGCTAGAGCTGCTAGATTGTCCGTTTGTGGTATT GCTGCTATCTGTCAAAAGAGAGGTTACAAGACCGGTCACATCGCTGCAGACGGTTCCGTT TCAACGAGATACCCAGGTTTCAAAGAAAAGGCTGCCAATGCTTTGAAGGACATTTACGGC TGGACTCAACCTCATCTAGACGACTACCCAATCAAGGTTGTTCCTGCTGAAGATGGTTCC GGTCCTGGTGCCGCTGTTATTGCTGCTTTGGCCCAAAAAAGAATTGCTGAAGGTAAGTCC GTTGGTATCATCGGTGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues486
Protein Molecular Weight53942.0
Protein Theoretical pI4.93
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Hexokinase-2 MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFISELEKGLSKKG GNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYRLPDAMRT TQNPDELWEFIADSLKAFIDEQFPQGISEPIPLGFTFSFPASQNKINEGILQRWTKGFDI PNIENHDVVPMLQKQITKRNIPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAY YDVCSDIEKLQGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARIEEDPFENLED TDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGIAAICQKRGYKTGHIAADGSV YNRYPGFKEKAANALKDIYGWTQTSLDDYPIKIVPAEDGSGAGAAVIAALAQKRIAEGKS VGIIGA
References
External Links
ResourceLink
Saccharomyces Genome Database HXK2
Uniprot IDP04807
Uniprot NameHXKB_YEAST
GenBank Gene IDM11181
Genebank Protein ID171735
PDB ID
1IG8
General Reference
  • Norbeck, J., Blomberg, A. (1995). "Gene linkage of two-dimensional polyacrylamide gel electrophoresis resolved proteins from isogene families in Saccharomyces cerevisiae by microsequencing of in-gel trypsin generated peptides." Electrophoresis 16:149-156.7737086
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Anderson, C. M., Stenkamp, R. E., Steitz, T. A. (1978). "Sequencing a protein by x-ray crystallography. II. Refinement of yeast hexokinase B co-ordinates and sequence at 2.1 A resolution." J Mol Biol 123:15-33.355643
  • Breitwieser, W., Price, C., Schuster, T. (1993). "Identification of a gene encoding a novel zinc finger protein in Saccharomyces cerevisiae." Yeast 9:551-556.8322518
  • Raushel, F. M., Cleland, W. W. (1973). "The substrate and anomeric specificity of fructokinase." J Biol Chem 248:8174-8177.4356621
  • Stachelek, C., Stachelek, J., Swan, J., Botstein, D., Konigsberg, W. (1986). "Identification, cloning and sequence determination of the genes specifying hexokinase A and B from yeast." Nucleic Acids Res 14:945-963.3003701
  • Coissac, E., Maillier, E., Robineau, S., Netter, P. (1996). "Sequence of a 39,411 bp DNA fragment covering the left end of chromosome VII of Saccharomyces cerevisiae." Yeast 12:1555-1562.8972578
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Behlke, J., Heidrich, K., Naumann, M., Muller, E. C., Otto, A., Reuter, R., Kriegel, T. (1998). "Hexokinase 2 from Saccharomyces cerevisiae: regulation of oligomeric structure by in vivo phosphorylation at serine-14." Biochemistry 37:11989-11995.9718324
  • Kriegel, T. M., Rush, J., Vojtek, A. B., Clifton, D., Fraenkel, D. G. (1994). "In vivo phosphorylation site of hexokinase 2 in Saccharomyces cerevisiae." Biochemistry 33:148-152.8286332
  • Heidrich, K., Otto, A., Behlke, J., Rush, J., Wenzel, K. W., Kriegel, T. (1997). "Autophosphorylation-inactivation site of hexokinase 2 in Saccharomyces cerevisiae." Biochemistry 36:1960-1964.9047292
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Frohlich, K. U., Entian, K. D., Mecke, D. (1985). "The primary structure of the yeast hexokinase PII gene (HXK2) which is responsible for glucose repression." Gene 36:105-111.3905511
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433