You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAnthranilate synthase component 1
Synonyms
  • Anthranilate synthase component I
Gene NameTRP2
Enzyme Class
Biological Properties
General FunctionInvolved in biosynthetic process
Specific FunctionChorismate + L-glutamine = anthranilate + pyruvate + L-glutamate
Cellular LocationNot Available
SMPDB Pathways
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
Chorismate + L-GlutaminePyruvic acid + L-Glutamic acid + hydron + 2-Aminobenzoic acid
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00148ChorismateShow
YMDB00175Pyruvic acidShow
YMDB00271L-Glutamic acidShow
YMDB002782-Aminobenzoic acidShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxo-acid-lyase activity
anthranilate synthase activity
lyase activity
carbon-carbon lyase activity
catalytic activity
Process
tryptophan biosynthetic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
indolalkylamine metabolic process
tryptophan metabolic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER090W
Gene Sequence>1524 bp ATGACCGCTTCCATCAAAATTCAACCGGATATTGACTCTCTAAAGCAATTACAGCAGCAA AATGACGATAGTTCCATAAATATGTATCCCGTGTATGCGTATTTGCCATCATTGGATCTG ACTCCTCACGTGGCATATCTAAAATTGGCACAATTGAACAACCCTGATAGAAAGGAATCA TTTCTGTTGGAAAGTGCTAAGACAAATAATGAATTAGATCGTTATTCATTCATAGGTATC TCGCCACGCAAGACCATCAAAACCGGTCCTACTGAAGGCATTGAAACAGATCCTTTGGAA ATTTTGGAAAAGGAGATGTCTACCTTTAAAGTAGCCGAAAATGTTCCTGGTTTACCGAAA TTAAGTGGTGGTGCTATTGGTTATATTTCTTATGACTGTGTTCGTTATTTCGAGCCAAAA ACAAGAAGGCCTTTGAAAGATGTCCTAAGACTTCCAGAGGCATATTTAATGCTTTGTGAT ACCATTATTGCCTTTGATAATGTTTTTCAGAGATTTCAAATCATTCATAACATTAATACC AATGAAACTTCGTTGGAGGAAGGTTACCAAGCTGCAGCACAAATAATCACTGATATCGTA TCAAAGCTAACCGACGATTCCTCGCCAATACCATATCCAGAACAACCTCCTATTAAATTG AATCAAACTTTTGAATCGAATGTGGGCAAGGAAGGTTACGAAAATCACGTCTCCACTTTG AAGAAGCATATTAAGAAAGGTGATATTATTCAAGGTGTGCCATCGCAAAGAGTGGCAAGG CCAACTTCGTTACATCCTTTCAATATTTACAGACATTTACGTACAGTGAACCCATCTCCT TACCTGTTTTATATTGATTGTTTGGATTTCCAAATCATTGGTGCATCTCCAGAATTGTTG TGCAAATCGGATTCCAAAAATAGAGTCATTACCCATCCAATTGCTGGTACTGTCAAACGT GGGGCTACTACTGAAGAGGATGATGCTTTAGCGGACCAATTACGTGGCTCGTTAAAAGAC CGTGCAGAACATGTTATGCTGGTAGATTTAGCAAGAAACGATATTAACAGAATTTGTGAC CCATTAACAACAAGTGTCGATAAACTGTTAACTATTCAAAAATTTTCTCATGTCCAACAT CTGGTTTCTCAAGTCAGCGGTGTTCTCCGCCCAGAAAAGACAAGATTTGATGCATTCAGA TCGATTTTCCCTGCAGGTACTGTCAGTGGTGCTCCAAAGGTTAGAGCCATGGAATTGATT GCCGAACTAGAAGGAGAAAGGCGTGGGGTTTATGCAGGCGCCGTAGGTCATTGGTCATAC GACGGTAAAACAATGGACAATTGTATCGCTTTAAGGACTATGGTCTATAAAGATGGCATT GCTTACTTGCAAGCTGGCGGTGGTATTGTTTACGATTCAGATGAGTACGATGAATATGTC GAAACCATGAATAAAATGATGGCCAATCACAGTACTATTGTGCAAGCAGAAGAATTGTGG GCCGATATCGTAGGATCAGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues507
Protein Molecular Weight56767.0
Protein Theoretical pI5.65
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Anthranilate synthase component 1 MTASIKIQPDIDSLKQLQQQNDDSSINMYPVYAYLPSLDLTPHVAYLKLAQLNNPDRKES FLLESAKTNNELDRYSFIGISPRKTIKTGPTEGIETDPLEILEKEMSTFKVAENVPGLPK LSGGAIGYISYDCVRYFEPKTRRPLKDVLRLPEAYLMLCDTIIAFDNVFQRFQIIHNINT NETSLEEGYQAAAQIITDIVSKLTDDSSPIPYPEQPPIKLNQTFESNVGKEGYENHVSTL KKHIKKGDIIQGVPSQRVARPTSLHPFNIYRHLRTVNPSPYLFYIDCLDFQIIGASPELL CKSDSKNRVITHPIAGTVKRGATTEEDDALADQLRGSLKDRAEHVMLVDLARNDINRICD PLTTSVDKLLTIQKFSHVQHLVSQVSGVLRPEKTRFDAFRSIFPAGTVSGAPKVRAMELI AELEGERRGVYAGAVGHWSYDGKTMDNCIALRTMVYKDGIAYLQAGGGIVYDSDEYDEYV ETMNKMMANHSTIVQAEELWADIVGSA
References
External Links
ResourceLink
Saccharomyces Genome Database TRP2
Uniprot IDP00899
Uniprot NameTRPE_YEAST
GenBank Gene IDU18839
Genebank Protein ID603328
General Reference
  • Zalkin, H., Paluh, J. L., van Cleemput, M., Moye, W. S., Yanofsky, C. (1984). "Nucleotide sequence of Saccharomyces cerevisiae genes TRP2 and TRP3 encoding bifunctional anthranilate synthase: indole-3-glycerol phosphate synthase." J Biol Chem 259:3985-3992.6323449
  • Graf, R., Mehmann, B., Braus, G. H. (1993). "Analysis of feedback-resistant anthranilate synthases from Saccharomyces cerevisiae." J Bacteriol 175:1061-1068.8432699
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Boucherie, H., Dujardin, G., Kermorgant, M., Monribot, C., Slonimski, P., Perrot, M. (1995). "Two-dimensional protein map of Saccharomyces cerevisiae: construction of a gene-protein index." Yeast 11:601-613.7483834
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956