You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSerine hydroxymethyltransferase, cytosolic
Synonyms
  • SHMT
  • Glycine hydroxymethyltransferase
  • Serine methylase
Gene NameSHM2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInterconversion of serine and glycine
Cellular LocationCytoplasm
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cyanoamino acid metabolismec00460 Map00460
Glycine, serine and threonine metabolismec00260 Map00260
Methane metabolismec00680 Map00680
One carbon pool by folateec00670 Map00670
SMPDB Reactions
L-Serine + Tetrahydrofolic acidwater + Glycine + 5,10-Methylene-THF
KEGG Reactions
L-Serine + 5,6,7,8-Tetrahydrofolic acidGlycine + water + 5,10-Methylene-THF
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00112L-SerineShow
YMDB00139Tetrahydrofolic acidShow
YMDB002605,10-Methylene-THFShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB00848(6R)-5,10-methylenetetrahydrofolic acidShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
glycine hydroxymethyltransferase activity
binding
cofactor binding
pyridoxal phosphate binding
catalytic activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
serine family amino acid metabolic process
glycine metabolic process
L-serine metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR058C
Gene Sequence>1410 bp ATGCCTTACACTCTATCCGACGCTCATCATAAGTTGATCACCTCTCATTTGGTGGACACC GACCCTGAAGTGGACTCCATTATCAAGGATGAAATTGAAAGACAAAAGCACTCCATCGAT TTGATTGCTTCTGAAAATTTCACCTCAACCTCCGTTTTCGATGCCCTTGGAACTCCATTG TCCAACAAATATTCTGAAGGTTATCCAGGTGCTCGTTACTACGGTGGTAATGAACACATT GACAGAATGGAAATTCTATGTCAACAAAGAGCTTTGAAAGCTTTCCATGTTACTCCAGAC AAATGGGGTGTTAACGTCCAAACTTTATCTGGTTCTCCTGCTAACTTGCAAGTTTATCAA GCTATTATGAAGCCTCATGAAAGATTGATGGGTCTATACCTACCAGATGGTGGTCATTTG TCTCACGGTTACGCTACTGAAAACAGAAAAATTTCTGCTGTTTCCACATACTTTGAATCT TTCCCATACAGAGTTAACCCAGAAACCGGTATTATCGACTACGATACTTTAGAAAAGAAC GCCATCCTATATAGACCAAAGGTTCTTGTTGCTGGTACTTCAGCATACTGTCGTTTAATT GACTACAAGAGAATGAGAGAAATCGCCGACAAATGTGGTGCTTACTTGATGGTAGACATG GCCCACATTTCTGGTTTGATCGCCGCAGGTGTCATCCCATCTCCTTTCGAATACGCTGAT ATCGTTACCACCACCACTCACAAGTCTTTGAGAGGTCCACGTGGTGCTATGATTTTCTTC AGAAGAGGTGTGAGATCTATCAACCCTAAGACCGGTAAGGAAGTTCTATACGACTTGGAA AACCCAATTAACTTCTCTGTTTTCCCAGGTCACCAAGGTGGTCCACACAACCATACCATT GCTGCTTTGGCCACTGCTTTGAAGCAAGCTGCCACTCCAGAATTCAAGGAATACCAAACT CAAGTCTTGAAGAATGCTAAGGCTTTGGAAAGTGAATTTAAGAACTTGGGCTACAGATTA GTTTCCAACGGTACCGATTCTCACATGGTTCTAGTATCCTTGAGAGAAAAGGGTGTTGAT GGTGCTCGTGTTGAATACATTTGTGAAAAGATTAACATTGCTTTGAACAAAAATTCTATT CCAGGTGACAAATCTGCTTTGGTTCCAGGTGGTGTCCGTATTGGGGCTCCAGCCATGACC ACTAGAGGAATGGGTGAAGAAGATTTCCACAGAATTGTTCAATACATTAACAAGGCTGTA GAATTCGCTCAACAAGTTCAACAAAAGCTTCCAAAGGATGCTTGTAGATTAAAGGACTTC AAAGCCAAGGTCGACGAAGGCTCTGATGTTTTGAACACCTGGAAAAAGGAAATTTACGAC TGGGCTGGCGAATACCCATTGGCTGTGTAA
Protein Properties
Pfam Domain Function
Protein Residues469
Protein Molecular Weight52218.0
Protein Theoretical pI7.47
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Serine hydroxymethyltransferase, cytosolic MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTSTSVFDALGTPL SNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPDKWGVNVQTLSGSPANLQVYQ AIMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFESFPYRVNPETGIIDYDTLEKN AILYRPKVLVAGTSAYCRLIDYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYAD IVTTTTHKSLRGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMVLVSLREKGVD GARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMTTRGMGEEDFHRIVQYINKAV EFAQQVQQSLPKDACRLKDFKAKVDEGSDVLNTWKKEIYDWAGEYPLAV
References
External Links
ResourceLink
Saccharomyces Genome Database SHM2
Uniprot IDP37291
Uniprot NameGLYC_YEAST
GenBank Gene IDL22529
Genebank Protein ID439120
General Reference
  • McNeil, J. B., McIntosh, E. M., Taylor, B. V., Zhang, F. R., Tang, S., Bognar, A. L. (1994). "Cloning and molecular characterization of three genes, including two genes encoding serine hydroxymethyltransferases, whose inactivation is required to render yeast auxotrophic for glycine." J Biol Chem 269:9155-9165.8132653
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Norbeck, J., Blomberg, A. (1997). "Two-dimensional electrophoretic separation of yeast proteins using a non-linear wide range (pH 3-10) immobilized pH gradient in the first dimension; reproducibility and evidence for isoelectric focusing of alkaline (pI > 7) proteins." Yeast 13:1519-1534.9509572
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956