Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDiphosphoinositol polyphosphate phosphohydrolase DDP1
Synonyms
  • Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase
  • AP6A hydrolase
  • Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1
Gene NameDDP1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionMay eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5',5'''-P1,P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5',5'''-P1,P5-pentaphosphate (Ap5A), adenosine 5'-pentaphosphate, and adenosine 5'-tetraphosphate are also substrates, but not diadenosine 5',5'''-P1,P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate)
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
water + 4-Diphospho-1D-myo-inositol pentakisphosphateMyo-Inositol hexakisphosphate + phosphate + hydron
5-Diphosphoinositol pentakisphosphate + waterMyo-Inositol hexakisphosphate + phosphate + hydron
water + 6-Diphospho-1D-myo-inositol pentakisphosphateMyo-Inositol hexakisphosphate + phosphate + hydron
5,6-Bis(diphospho)-1D-myo-inositol tetrakisphosphate + waterhydron + phosphate + Inositol 1,3,4,5,6-pentakisphosphate
Metabolites
YMDB IDNameView
YMDB000135-Diphosphoinositol pentakisphosphateShow
YMDB00500Myo-Inositol hexakisphosphateShow
YMDB005014-Diphospho-1D-myo-inositol pentakisphosphateShow
YMDB005215,6-Bis(diphospho)-1D-myo-inositol tetrakisphosphateShow
YMDB005236-Diphospho-1D-myo-inositol pentakisphosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00946Inositol 1,3,4,5,6-pentakisphosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 15
LocusYOR163W
Gene Sequence>567 bp ATGGGCAAAACCGCGGATAATCATGGTCCAGTACGTTCTGAGACAGCACGTGAAGGAAGA GAAAACCAGGTTTACTCACCCGTTACAGGTGCAAGATTAGTTGCTGGCTGCATATGTTTA ACACCCGACAAGAAGCAAGTTCTCATGATTACTTCTTCTGCACACAAGAAAAGATGGATT GTCCCCAAAGGTGGCGTTGAGAAAGACGAGCCTAATTACGAGACGACTGCCCAACGAGAA ACTTGGGAGGAAGCTGGTTGCATAGGTAAAATTGTCGCCAATTTGGGTACAGTTGAAGAC ATGAGACCCCCTAAGGACTGGAACAAAGACATTAAGCAATTCGAGAACTCTCGAAAAGAT TCAGAAGTAGCAAAGCACCCGCCAAGAACCGAATTTCATTTTTATGAATTAGAGATTGAA AATCTCCTTGATAAATTTCCGGAATGTCACAAAAGACATAGAAAGCTATACTCTTATACA GAAGCTAAACAAAACTTGATAGACGCCAAGAGGCCTGAATTGTTGGAGGCCCTTAATAGG TCTGCTATCATTAAAGACGACAAATAG
Protein Properties
Pfam Domain Function
Protein Residues188
Protein Molecular Weight21572.30078
Protein Theoretical pI8.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Diphosphoinositol polyphosphate phosphohydrolase DDP1 MGKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWI VPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKD SEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNR SAIIKDDK
References
External Links
ResourceLink
Saccharomyces Genome Database DDP1
Uniprot IDQ99321
Uniprot NameDDP1_YEAST
GenBank Gene IDAY558436
Genebank Protein ID45270762
General Reference
  • Madania, A., Poch, O., Tarassov, I., Winsor, B., Martin, R. (1996). "Analysis of a 22,956 bp region on the right arm of Saccharomyces cerevisiae chromosome XV." Yeast 12:1563-1573.8972579
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Cartwright, J. L., McLennan, A. G. (1999). "The Saccharomyces cerevisiae YOR163w gene encodes a diadenosine 5', 5"'-P1,P6-hexaphosphate (Ap6A) hydrolase member of the MutT motif (Nudix hydrolase) family." J Biol Chem 274:8604-8610.10085096
  • Safrany, S. T., Ingram, S. W., Cartwright, J. L., Falck, J. R., McLennan, A. G., Barnes, L. D., Shears, S. B. (1999). "The diadenosine hexaphosphate hydrolases from Schizosaccharomyces pombe and Saccharomyces cerevisiae are homologues of the human diphosphoinositol polyphosphate phosphohydrolase. Overlapping substrate specificities in a MutT-type protein." J Biol Chem 274:21735-21740.10419486
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956