You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutamate synthase [NADH]
Synonyms
  • NADH-GOGAT
Gene NameGLT1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionForms L-glutamate from L-glutamine and 2-oxoglutarate. Represents an alternative pathway to L-glutamate dehydrogenase for the biosynthesis of L-glutamate. Participates with glutamine synthetase in ammonia assimilation processes. The enzyme is specific for NADH, L-glutamine and 2-oxoglutarate
Cellular LocationNot Available
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
L-Glutamine + Oxoglutaric acid + hydron + NADHL-Glutamic acid + NAD
L-Glutamine + Oxoglutaric acid + NADHNAD + L-Glutamic acid
KEGG Reactions
NADH + Oxoglutaric acid + L-Glutamine + hydronL-Glutamic acid + NAD
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00412NAD(+)Show
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
nucleoside binding
iron ion binding
purine nucleoside binding
oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
catalytic activity
adenyl nucleotide binding
oxidoreductase activity, acting on the CH-NH2 group of donors
nucleotide binding
glutamate synthase activity
FAD or FADH2 binding
metal cluster binding
glutamate synthase activity, NADH or NADPH as acceptor
iron-sulfur cluster binding
FMN binding
oxidoreductase activity
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
Process
metabolic process
nitrogen compound metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
oxidation reduction
cellular amino acid metabolic process
glutamate metabolic process
glutamine family amino acid metabolic process
glutamate biosynthetic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL171C
Gene Sequence>6438 bp ATGCCAGTGTTGAAATCAGACAATTTCGATCCATTGGAAGAAGCTTACGAAGGTGGGACA ATTCAAAACTATAACGATGAACACCATCTTCATAAATCTTGGGCAAATGTGATTCCGGAC AAACGAGGACTTTACGACCCTGATTATGAACATGACGCTTGTGGTGTCGGTTTCGTAGCA AATAAGCATGGTGAACAGTCTCACAAGATTGTTACTGACGCTAGATATCTTTTAGTGAAT ATGACACATCGTGGTGCCGTCTCATCTGATGGGAACGGTGACGGTGCCGGTATTCTGCTA GGTATTCCTCACGAATTTATGAAAAGAGAATTCAAGTTAGATCTTGATCTAGACATACCT GAGATGGGCAAATACGCCGTAGGTAACGTCTTCTTCAAGAAGAACGAAAAAAATAACAAG AAAAATTTAATTAAGTGTCAGAAGATTTTCGAGGATTTAGCTGCATCCTTCAACTTATCC GTATTAGGTTGGAGAAACGTCCCCGTAGATTCTACTATTTTAGGAGACGTTGCATTATCT CGTGAACCTACTATTCTACAGCCATTATTGGTTCCATTGTATGATGAAAAACAACCGGAG TTTAATGAAACTAAATTTAGAACTCAATTGTATCTTTTAAGGAAGGAGGCCTCTCTTCAA ATAGGACTGGAAAACTGGTTCTATGTTTGTTCCCTAAACAATACCACCATTGTTTACAAG GGTCAATTGACGCCAGCTCAAGTGTATAACTACTATCCCGACTTGACTAATGCGCATTTC AAATCCCACATGGCGTTGGTCCATTCAAGATTTTCCACTAATACTTTCCCCTCTTGGGAT AGAGCTCAACCTTTACGTTGGCTAGCTCATAATGGTGAAATTAACACCTTAAGAGGTAAC AAGAATTGGATGCGCTCCAGAGAAGGTGTGATGAATTCAGCAACTTTCAAAGATGAGTTA GACAAACTATACCCAATTATCGAAGAAGGTGGTTCTGATTCAGCTGCATTGGATAACGTT TTAGAACTATTGACTATTAATGGCACATTATCTCTACCTGAAGCTGTTATGATGATGGTT CCTGAAGCGTATCATAAGGATATGGATTCTGACCTAAAAGCATGGTACGACTGGGCTGCA TGTCTGATGGAACCTTGGGATGGTCCAGCTTTGTTAACTTTCACTGATGGACGTTACTGT GGTGCTATATTGGATAGAAATGGTTTAAGACCTTGTCGTTATTACATCACTAGTGATGAC AGAGTTATCTGTGCTTCAGAGGTAGGTGTCATTCCTATCGAAAATTCATTGGTTGTTCAA AAAGGTAAACTGAAGCCAGGTGATTTATTCCTAGTGGATACTCAATTGGGTGAAATGGTC GATACTAAAAAGTTAAAATCTCAAATCTCAAAAAGACAAGATTTTAAGTCTTGGTTATCC AAAGTCATCAAGTTAGACGACTTGTTATCAAAAACCGCTAATTTGGTTCCTAAAGAATTT ATATCACAGGATTCATTGTCTTTGAAAGTTCAAAGTGACCCACGTCTATTGGCCAATGGT TATACCTTCGAACAAGTCACATTTCTGTTAACTCCAATGGCTTTAACAGGTAAAGAAGCT TTAGGTTCGATGGGTAACGATGCGCCACTGGCTTGTTTAAATGAAAATCCTGTCTTACTT TATGATTATTTCAGACAATTGTTTGCTCAAGTGACCAATCCTCCAATTGACCCAATTCGT GAAGCAAATGTTATGTCGTTAGAATGTTATGTCGGACCTCAAGGCAACCTTTTGGAAATG CATTCATCTCAATGTGATCGTTTATTATTGAAATCTCCTATTTTGCATTGGAATGAGTTC CAAGCTTTGAAAAACATTGAAGCTGCTTACCCATCATGGTCTGTAGCAGAAATTGATATC ACATTCGACAAGAGTGAGGGTCTATTGGGCTATACCGACACAATTGATAAAATCACTAAG TTAGCGAGCGAAGCAATTGATGATGGTAAAAAGATCTTAATAATTACTGACAGGAAAATG GGTGCCAACCGTGTTTCCATCTCCTCTTTGATTGCAATTTCATGTATTCATCATCACCTA ATCAGAAACAAGCAGCGTTCCCAAGTTGCTTTGATTTTGGAAACAGGTGAAGCCAGAGAA ATTCACCATTTCTGTGTCCTACTAGGTTATGGTTGTGATGGTGTTTATCCATACTTAGCC ATGGAAACTTTGGTCAGAATGAATAGAGAAGGTCTACTTCGTAATGTCAACAATGACAAT GATACACTTGAGGAAGGGCAAATACTAGAAAATTACAAGCACGCTATTGATGCAGGTATC TTGAAGGTTATGTCTAAAATGGGTATCTCCACTCTAGCATCCTACAAAGGTGCTCAAATT TTTGAAGCCCTAGGTTTAGATAACTCTATTGTTGATTTGTGTTTCACAGGTACTTCTTCC AGAATTAGAGGTGTAACTTTCGAGTATTTGGCTCAAGATGCCTTTTCTTTACATGAGCGT GGTTATCCATCCAGACAAACCATTAGTAAATCTGTTAACTTACCAGAAAGTGGTGAATAC CACTTTAGGGATGGTGGTTACAAACACGTCAACGAACCAACCGCAATTGCTTCGTTACAA GATACTGTCAGAAACAAAAATGATGTCTCTTGGCAATTATATGTAAAGAAGGAAATGGAA GCAATTAGAGACTGTACACTAAGAGGACTGTTAGAATTAGATTTTGAAAATTCTGTCAGT ATCCCTCTAGAACAAGTTGAACCATGGACTGAAATTGCCAGAAGATTTGCGTCAGGTGCA ATGTCTTATGGTTCTATTTCTATGGAAGCTCACTCTACATTGGCTATTGCCATGAATCGT TTAGGGGCCAAATCCAATTGTGGTGAAGGTGGTGAAGACGCAGAACGTTCTGCTGTTCAA GAAAACGGTGATACTATGAGATCTGCTATCAAACAAGTTGCTTCCGCTAGATTCGGTGTA ACTTCATACTACTTGTCAGATGCTGATGAAATCCAAATTAAGATTGCTCAGGGTGCTAAG CCGGGTGAAGGTGGTGAACTACCAGCCCACAAAGTGTCTAAGGATATCGCAAAAACCAGG CACTCCACCCCTAATGTTGGGTTAATCTCTCCTCCTCCTCATCACGATATTTATTCCATT GAAGATTTGAAACAACTGATTTATGATTTGAAATGTGCTAATCCAAGAGCGGGAATTTCT GTAAAGTTGGTTTCCGAAGTTGGTGTTGGTATTGTTGCCTCTGGTGTAGCTAAGGCTAAA GCCGATCATATCTTAGTTTCTGGTCATGATGGTGGTACAGGTGCTGCAAGATGGACGAGT GTCAAATATGCGGGTTTGCCATGGGAATTAGGTCTAGCTGAAACTCACCAGACTTTAGTC TTGAATGATTTAAGACGTAATGTTGTTGTCCAAACCGATGGTCAATTGAGAACTGGGTTT GATATTGCTGTTGCAGTTTTATTAGGGGCAGAATCTTTTACCTTGGCAACAGTTCCATTA ATTGCTATGGGTTGTGTTATGTTAAGAAGATGTCACTTGAACTCTTGTGCTGTTGGTATT GCCACACAAGATCCATATTTGAGAAGTAAGTTTAAGGGTCAGCCCGAACATGTTATCAAC TTCTTCTATTACTTGATCCAAGATTTAAGACAAATCATGGCCAAGTTAGGATTCCGTACC ATTGACGAAATGGTGGGTCATTCTGAAAAATTAAAGAAAAGGGACGACGTAAATGCCAAA GCCATAAATATCGATTTATCTCCTATTTTGACCCCAGCACATGTTATTCGTCCAGGTGTT CCAACCAAGTTCACTAAGAAACAAGACCACAAACTCCACACCCGTCTAGATAATAAGTTA ATCGATGAGGCTGAAGTTACTTTGGATCGTGGCTTACCAGTGAATATTGACGCCTCTATA ATCAATACTGATCGTGCACTCGGTTCTACTTTATCTTACAGAGTCTCGAAGAAATTTGGT GAAGATGGTTTGCCAAAGGACACCGTTGTCGTTAACATAGAAGGTTCAGCGGGTCAATCT TTTGGTGCTTTCCTAGCTTCTGGTATCACTTTTATCTTGAATGGTGATGCTAATGATTAT GTTGGTAAAGGTTTATCCGGTGGTATTATTGTCATTAAACCACCAAAGGATTCTAAATTC AAGAGTGATGAAAATGTAATTGTTGGTAACACTTGTTTCTATGGTGCTACTTCTGGTACT GCATTCATTTCAGGTAGTGCCGGTGAGCGTTTCGGTGTCAGAAACTCTGGTGCCACCATC GTTGTTGAGAGAATTAAGGGTAACAATGCCTTTGAGTATATGACTGGTGGTCGTGCCATT GTCTTATCACAAATGGAATCCCTAAACGCCTTCTCTGGTGCTACTGGTGGTATTGCATAC TGTTTAACTTCCGATTACGACGATTTTGTTGGAAAGATTAACAAAGATACTGTTGAGTTA GAATCATTATGTGACCCGGTCGAGATTGCGTTTGTTAAGAATTTGATCCAGGAGCATTGG AACTACACACAATCTGATCTAGCAGCCAGGATTCTCGGTAATTTCAACCATTATTTGAAA GATTTCGTTAAAGTCATTCCAACTGATTATAAGAAAGTTTTGTTGAAGGAGAAAGCAGAA GCTGCCAAGGCAAAGGCTAAGGCAACTTCAGAATACTTAAAGAAGTTTAGATCGAACCAA GAAGTTGATGACGAAGTCAATACTCTATTGATTGCTAATCAAAAAGCTAAAGAGCAAGAA AAAAAGAAGAGTATTACTATTTCAAATAAGGCCACTTTGAAGGAGCCTAAGGTTGTTGAT TTAGAAGATGCAGTTCCAGATTCCAAACAGCTAGAGAAGAATAGCGAAAGGATTGAAAAA ACACGTGGTTTTATGATCCACAAACGTCGTCATGAGACACACAGAGATCCAAGAACCAGA GTTAATGACTGGAAAGAATTTACTAACCCTATTACCAAGAAGGATGCCAAATATCAAACT GCGAGATGTATGGATTGTGGTACACCATTCTGTTTATCTGATACCGGTTGTCCCCTATCT AACATTATCCCCAAGTTTAATGAATTGTTATTCAAGAACCAATGGAAGTTGGCACTGGAC AAATTGCTAGAGACAAACAATTTCCCAGAATTCACTGGAAGAGTATGTCCAGCACCCTGT GAGGGAGCTTGTACACTAGGTATTATTGAAGACCCAGTCGGCATAAAATCGGTTGAAAGA ATTATCATTGACAATGCTTTCAAGGAAGGATGGATTAAGCCTTGTCCACCAAGTACACGC ACTGGCTTTACAGTGGGTGTCATTGGTTCTGGTCCAGCAGGTTTAGCGTGTGCTGATATG TTGAACCGTGCCGGACATACGGTCACTGTTTATGAAAGATCCGACCGTTGTGGTGGGTTA TTGATGTATGGTATTCCAAACATGAAGTTGGATAAGGCTATAGTGCAACGTCGTATTGAT CTATTGAGTGCCGAAGGTATTGACTTTGTTACCAACACCGAAATTGGTAAAACCATAAGC ATGGATGAGCTAAAGAACAAGCACAATGCAGTAGTGTATGCTATCGGTTCTACCATTCCA CGTGACTTACCTATTAAGGGTCGTGAATTGAAGAATATTGATTTTGCCATGCAGTTGTTG GAATCTAACACAAAAGCTTTATTGAACAAAGATCTGGAAATCATTCGTGAAAAGATCCAA GGTAAGAAAGTAATTGTTGTCGGTGGTGGTGACACAGGTAACGATTGTTTAGGTACATCT GTAAGACACGGTGCAGCATCAGTTTTGAATTTCGAATTGTTGCCTGAGCCACCAGTGGAA CGTGCCAAAGACAATCCATGGCCTCAATGGCCGCGTGTCATGAGAGTGGACTACGGTCAT GCTGAAGTGAAAGAGCATTATGGTAGAGACCCTCGTGAATACTGCATCTTGTCCAAGGAA TTTATCGGTAACGATGAGGGTGAAGTCACTGCCATCAGAACTGTGCGCGTAGAATGGAAG AAGTCACAAAGTGGCGTATGGCAAATGGTAGAAATTCCCAACAGTGAAGAGATCTTTGAA GCCGATATCATTTTGTTGTCTATGGGTTTCGTGGGTCCTGAATTGATCAATGGCAACGAT AACGAAGTTAAGAAGACAAGACGTGGTACGATTGCCACACTCGACGACTCCTCATACTCT ATTGATGGAGGAAAGACTTTTGCATGTGGTGACTGTAGAAGAGGGCAATCTTTGATTGTC TGGGCCATCCAAGAAGGTAGAAAATGTGCTGCCTCTGTCGATAAGTTCCTAATGGACGGC ACTACGTATCTACCAAGTAATGGTGGTATCGTTCAACGTGATTACAAACTATTGAAAGAA TTAGCTAGTCAAGTCTAA
Protein Properties
Pfam Domain Function
Protein Residues2145
Protein Molecular Weight238100.0
Protein Theoretical pI6.55
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutamate synthase [NADH] MPVLKSDNFDPLEEAYEGGTIQNYNDEHHLHKSWANVIPDKRGLYDPDYEHDACGVGFVA NKHGEQSHKIVTDARYLLVNMTHRGAVSSDGNGDGAGILLGIPHEFMKREFKLDLDLDIP EMGKYAVGNVFFKKNEKNNKKNLIKCQKIFEDLAASFNLSVLGWRNVPVDSTILGDVALS REPTILQPLLVPLYDEKQPEFNETKFRTQLYLLRKEASLQIGLENWFYVCSLNNTTIVYK GQLTPAQVYNYYPDLTNAHFKSHMALVHSRFSTNTFPSWDRAQPLRWLAHNGEINTLRGN KNWMRSREGVMNSATFKDELDKLYPIIEEGGSDSAALDNVLELLTINGTLSLPEAVMMMV PEAYHKDMDSDLKAWYDWAACLMEPWDGPALLTFTDGRYCGAILDRNGLRPCRYYITSDD RVICASEVGVIPIENSLVVQKGKLKPGDLFLVDTQLGEMVDTKKLKSQISKRQDFKSWLS KVIKLDDLLSKTANLVPKEFISQDSLSLKVQSDPRLLANGYTFEQVTFLLTPMALTGKEA LGSMGNDAPLACLNENPVLLYDYFRQLFAQVTNPPIDPIREANVMSLECYVGPQGNLLEM HSSQCDRLLLKSPILHWNEFQALKNIEAAYPSWSVAEIDITFDKSEGLLGYTDTIDKITK LASEAIDDGKKILIITDRKMGANRVSISSLIAISCIHHHLIRNKQRSQVALILETGEARE IHHFCVLLGYGCDGVYPYLAMETLVRMNREGLLRNVNNDNDTLEEGQILENYKHAIDAGI LKVMSKMGISTLASYKGAQIFEALGLDNSIVDLCFTGTSSRIRGVTFEYLAQDAFSLHER GYPSRQTISKSVNLPESGEYHFRDGGYKHVNEPTAIASLQDTVRNKNDVSWQLYVKKEME AIRDCTLRGLLELDFENSVSIPLEQVEPWTEIARRFASGAMSYGSISMEAHSTLAIAMNR LGAKSNCGEGGEDAERSAVQENGDTMRSAIKQVASARFGVTSYYLSDADEIQIKIAQGAK PGEGGELPAHKVSKDIAKTRHSTPNVGLISPPPHHDIYSIEDLKQLIYDLKCANPRAGIS VKLVSEVGVGIVASGVAKAKADHILVSGHDGGTGAARWTSVKYAGLPWELGLAETHQTLV LNDLRRNVVVQTDGQLRTGFDIAVAVLLGAESFTLATVPLIAMGCVMLRRCHLNSCAVGI ATQDPYLRSKFKGQPEHVINFFYYLIQDLRQIMAKLGFRTIDEMVGHSEKLKKRDDVNAK AINIDLSPILTPAHVIRPGVPTKFTKKQDHKLHTRLDNKLIDEAEVTLDRGLPVNIDASI INTDRALGSTLSYRVSKKFGEDGLPKDTVVVNIEGSAGQSFGAFLASGITFILNGDANDY VGKGLSGGIIVIKPPKDSKFKSDENVIVGNTCFYGATSGTAFISGSAGERFGVRNSGATI VVERIKGNNAFEYMTGGRAIVLSQMESLNAFSGATGGIAYCLTSDYDDFVGKINKDTVEL ESLCDPVEIAFVKNLIQEHWNYTQSDLAARILGNFNHYLKDFVKVIPTDYKKVLLKEKAE AAKAKAKATSEYLKKFRSNQEVDDEVNTLLIANQKAKEQEKKKSITISNKATLKEPKVVD LEDAVPDSKQLEKNSERIEKTRGFMIHKRRHETHRDPRTRVNDWKEFTNPITKKDAKYQT ARCMDCGTPFCLSDTGCPLSNIIPKFNELLFKNQWKLALDKLLETNNFPEFTGRVCPAPC EGACTLGIIEDPVGIKSVERIIIDNAFKEGWIKPCPPSTRTGFTVGVIGSGPAGLACADM LNRAGHTVTVYERSDRCGGLLMYGIPNMKLDKAIVQRRIDLLSAEGIDFVTNTEIGKTIS MDELKNKHNAVVYAIGSTIPRDLPIKGRELKNIDFAMQLLESNTKALLNKDLEIIREKIQ GKKVIVVGGGDTGNDCLGTSVRHGAASVLNFELLPEPPVERAKDNPWPQWPRVMRVDYGH AEVKEHYGRDPREYCILSKEFIGNDEGEVTAIRTVRVEWKKSQSGVWQMVEIPNSEEIFE ADIILLSMGFVGPELINGNDNEVKKTRRGTIATLDDSSYSIDGGKTFACGDCRRGQSLIV WAIQEGRKCAASVDKFLMDGTTYLPSNGGIVQRDYKLLKELASQV
References
External Links
ResourceLink
Saccharomyces Genome Database GLT1
Uniprot IDQ12680
Uniprot NameGLT1_YEAST
GenBank Gene IDZ67750
Genebank Protein ID1061267
General Reference
  • Filetici, P., Martegani, M. P., Valenzuela, L., Gonzalez, A., Ballario, P. (1996). "Sequence of the GLT1 gene from Saccharomyces cerevisiae reveals the domain structure of yeast glutamate synthase." Yeast 12:1359-1366.8923741
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Cogoni, C., Valenzuela, L., Gonzalez-Halphen, D., Olivera, H., Macino, G., Ballario, P., Gonzalez, A. (1995). "Saccharomyces cerevisiae has a single glutamate synthase gene coding for a plant-like high-molecular-weight polypeptide." J Bacteriol 177:792-798.7836314
  • Roon, R. J., Even, H. L., Larimore, F. (1974). "Glutamate synthase: properties of the reduced nicotinamide adenine dinucleotide-dependent enzyme from Saccharomyces cerevisiae." J Bacteriol 118:89-95.4362465
  • 7047525
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106