You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha-ketoglutarate-dependent sulfonate dioxygenase
SynonymsNot Available
Gene NameJLP1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionActs as a alpha-ketoglutarate-dependent dioxygenase active on sulfonates. Although taurine is a poor substrate, a variety of other sulfonates are utilized, with the best natural substrates being isethionate and taurocholate
Cellular LocationNot Available
SMPDB Pathways
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Taurine + Oxoglutaric acid + oxygenSulfite + Succinic acid + Carbon dioxide + hydron + aminoacetaldehyde
KEGG Reactions
Oxoglutaric acid + Taurine + oxygenSulfite + Carbon dioxide + hydron + aminoacetaldehyde + Succinic acid
Metabolites
YMDB IDNameView
YMDB00114SulfiteShow
YMDB00153Oxoglutaric acidShow
YMDB00338Succinic acidShow
YMDB00771aminoacetaldehydeShow
YMDB00772TaurineShow
YMDB00862hydronShow
YMDB00900oxygenShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLL057C
Gene Sequence>1239 bp ATGTCTCCTGCAGCAGCTCAAACAGCAATCCCTCTTCCATCTACCGATTTACCAGTCAAA ATCATTACAAATGGGTTGAAAAACCTGAATTATACCTCCAAGCAAGGTTACGGGAATTTT GATACCCATTTTTATGATGGCCAAGATGAGGTCTCTCCATCTGGTTTATTGAAAATCCGT AAATCTTATAGAGAGAAATCGAAGTATCCAGATTATTTGCCTACATGGGATCCTACTGAA AAGTATGGCCCGCTGGAATTTCACGAATACCATGATCCTGCTTTGAGAGCTGACGGTAAC TTTTCAAACCTTTTTGCAAAAGAAAACGTTGGTCAACTAAAGGTGAAGAAGATCACCCCG AAATTAGGTCTCGAGATCAATGGGATCCAGCTAACTGATCTTTCTGATGCTGCAAAAGAT GAACTCGCTTTGCTTGTCGCCCAAAAGGGAGTAGTTGTCTTTAGAAATCAGAATTTTGCT GACGAGGGACCCGATTATGTGACTGAATACGGAAGACATTTTGGCAAGTTGCACATTCAT CAAACTAGTGGCCACCCTCAAAACAATCCTGAGCTGCATATCACTTTCCGAAGACCTGAT GCGGAAGAATTTGCAAGAGTTTTTGATGACTCGACATCATCTGGTGGCTGGCACACAGAC GTCTCTTACGAGTTACAGCCACCTTCTTATACTTTCTTTAGTGTTGTTGAAGGTCCTGAT GGTGGTGGAGATACGTTATTTGCGGATACGATCGAGGCTTTCGACAGGTTGTCGAAGCCT TTGCAAGATTTCTTGAGCACGCTTCATGTCATCCATAGCTCAAAGGAACAGGCAGAGAAT TCACAGCGCCAGGGCGGCATAAAAAGAAGAGCACCTGTCACGCATATTCATCCACTGGTC AGAGTTCATCCTGTCTTGAAAAAGAAATGCTTGTATGTCAATCGTGCATTTTCTAGGAAA ATAGTCGAATTGAAAAGACAAGAATCTGAATCACTTTTGAATTTCTTGTACAATCTAGTG GAGAGCAGCCATGATTTACAGTTAAGAGCCAAATGGGAACCTCATTCCGTCGTCATTTGG GATAACCGCAGAGTTCAACATTCAGCAGTGATTGATTGGGAAGAACCAATTCACAGACAT GCGTTCAGGATTACTCCACAAGCGGAAAGGCCCGTGGAAGATCTAAAGTTTTTGAATGAT GAAAATTATTATCCTTCTTCATTAACTTTGGATATTTGA
Protein Properties
Pfam Domain Function
Protein Residues412
Protein Molecular Weight46982.30078
Protein Theoretical pI6.65
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alpha-ketoglutarate-dependent sulfonate dioxygenase MSPAAAQTAIPLPSTDLPVKIITNGLKNLNYTSKQGYGNFDTHFYDGQDEVSPSGLLKIR KSYREKSKYPDYLPTWDPTEKYGPLEFHEYHDPALRADGNFSNLFAKENVGQLKVKKITP KLGLEINGIQLTDLSDAAKDELALLVAQKGVVVFRNQNFADEGPDYVTEYGRHFGKLHIH QTSGHPQNNPELHITFRRPDAEEFARVFDDSTSSGGWHTDVSYELQPPSYTFFSVVEGPD GGGDTLFADTIEAFDRLSKPLQDFLSTLHVIHSSKEQAENSQRQGGIKRRAPVTHIHPLV RVHPVLKKKCLYVNRAFSRKIVELKRQESESLLNFLYNLVESSHDLQLRAKWEPHSVVIW DNRRVQHSAVIDWEEPIHRHAFRITPQAERPVEDLKFLNDENYYPSSLTLDI
References
External Links
ResourceLink
Saccharomyces Genome Database JLP1
Uniprot IDQ12358
Uniprot NameJLP1_YEAST
GenBank Gene IDAY692737
Genebank Protein ID51012925
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Hogan, D. A., Auchtung, T. A., Hausinger, R. P. (1999). "Cloning and characterization of a sulfonate/alpha-ketoglutarate dioxygenase from Saccharomyces cerevisiae." J Bacteriol 181:5876-5879.10482536