You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHomocitrate synthase, mitochondrial
SynonymsNot Available
Gene NameLYS21
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Specific FunctionAcetyl-CoA + H(2)O + 2-oxoglutarate = (R)-2- hydroxybutane-1,2,4-tricarboxylate + CoA
Cellular LocationMitochondrion (Potential)
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
lysine metabolismPW002420 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Lysine biosynthesisec00300 Map00300
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Oxoglutaric acid + Acetyl-CoA + waterCoenzyme A + (2R)-Homocitric acid + hydron
Acetyl-CoA + water(2R)-Homocitric acid + Coenzyme A
KEGG Reactions
Oxoglutaric acid + Acetyl-CoA + waterTetradecanoyl-CoA + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00096(2R)-Homocitric acidShow
YMDB00153Oxoglutaric acidShow
YMDB00312Acetyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL131W
Gene Sequence>1323 bp ATGTCTGAAAATAACGAATTCCAGAGTGTCACCGAATCGACGACTGCTCCAACCACTAGT AACCCATATGGCCCAAATCCTGCGGATTATCTATCCAATGTTAAGAATTTCCAGTTGATT GATTCAACACTAAGAGAGGGTGAACAATTTGCCAACGCATTCTTCGATACTGAAAAAAAG ATTGAAATTGCTAGAGCCTTGGATGATTTCGGTGTGGACTACATCGAGTTAACCTCTCCC GTAGCATCCGAACAATCAAGAAAGGACTGTGAAGCTATATGTAAACTAGGTTTAAAGGCC AAGATCCTTACACACATTCGTTGTCACATGGACGATGCCAGAGTCGCCGTAGAGACTGGT GTCGACGGTGTCGATGTTGTTATCGGCACCTCCAAATTTTTAAGACAATATTCCCACGGT AAGGATATGAACTACATCGCCAAGAGTGCTGTTGAAGTCATTGAATTTGTCAAATCCAAA GGTATTGAAATCAGATTTTCCTCTGAAGATTCCTTCAGAAGTGATCTCGTTGATCTTTTG AACATTTATAAAACCGTTGACAAGATCGGTGTAAATAGAGTCGGTATTGCCGACACAGTT GGATGTGCCAACCCAAGACAAGTATATGAACTGATCAGAACTTTGAAGAGTGTTGTCTCA TGTGACATCGAATGCCATTTCCACAATGATACCGGTTGTGCCATTGCAAACGCCTACACT GCTTTGGAAGGTGGTGCCAGATTGATTGACGTCAGTGTACTGGGTATTGGTGAAAGAAAC GGTATCACTCCTCTAGGTGGGCTCATGGCAAGAATGATTGTTGCCGCACCAGACTATGTC AGATCTAAATACAAGCTGCACAAGATCAGAGACATCGAAAACCTGGTCGCTGATGCTGTG GAAGTTAACATTCCATTCAACAACCCTATCACCGGGTTCTGTGCATTCACACATAAAGCA GGTATCCATGCCAAGGCCATTTTGGCTAACCCATCTACCTACGAAATCTTGGACCCTCAC GATTTCGGTATGAAGAGATATATCCACTTCGCCAACAGACTAACTGGTTGGAATGCAATC AAATCAAGAGTCGACCAATTGAACTTGAATTTGACGGATGATCAAATCAAGGAAGTTACT GCTAAGATTAAGAAGCTGGGTGATGTCAGACCGCTAAATATTGATGATGTAGACTCCATT ATCAAGGACTTCCATGCAGAATTGAGCACCCCACTTTTAAAACCAGTAAATAAGGGTACA GATGACGACAATATCGATATTTCCAATGGGCATGTTTCTAAAAAGGCAAAGGTCACCAAA TAG
Protein Properties
Pfam Domain Function
Protein Residues440
Protein Molecular Weight48593.80078
Protein Theoretical pI6.25
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Homocitrate synthase, mitochondrial MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQFANAFFDTEKK IEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDARVAVETG VDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEIRFSSEDSFRSDLVDLL NIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYT ALEGGARLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAI KSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSIIKDFHAELSTPLLKPVNKGT DDDNIDISNGHVSKKAKVTK
References
External Links
ResourceLink
Saccharomyces Genome Database LYS21
Uniprot IDQ12122
Uniprot NameHOSM_YEAST
GenBank Gene IDX96876
Genebank Protein ID1419231
General Reference
  • Wolfl, S., Hanemann, V., Saluz, H. P. (1996). "Analysis of a 26,756 bp segment from the left arm of yeast chromosome IV." Yeast 12:1549-1554.8972577
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956