You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoglycerate mutase 2
Synonyms
  • PGAM 2
  • BPG-dependent PGAM 2
  • MPGM 2
  • Phosphoglyceromutase 2
Gene NameGPM2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCould be non-functional
Cellular LocationCytoplasm
SMPDB Pathways
Glycolysis IPW002386 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
Methane metabolismec00680 Map00680
SMPDB Reactions
Glyceric acid 1,3-biphosphate2,3-bisphospho-D-glyceric acid
2,3-bisphospho-D-glyceric acid + water3-Phosphoglyceric acid + phosphate
3-Phosphoglyceric acid2-phospho-D-glyceric acid
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00270Glyceric acid 1,3-biphosphateShow
YMDB003413-Phosphoglyceric acidShow
YMDB006712,3-bisphospho-D-glyceric acidShow
YMDB006752-phospho-D-glyceric acidShow
YMDB007563-phospho-D-glyceric acidShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB009852-phospho-d-glycerateShow
GO Classification
Component
Not Available
Function
isomerase activity
intramolecular transferase activity
intramolecular transferase activity, phosphotransferases
catalytic activity
Process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
metabolic process
small molecule metabolic process
alcohol metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL021W
Gene Sequence>936 bp ATGACTGCAAGCACACCATCCAATGTCATGACATTGTTCTTGTTAAGGCATGGACAAAGT GAATTGAATCACGAGAATATATTCTGTGGTTGGATTGACGCTAAGCTAACCGAAAAAGGT AAAGAACAAGCTCGTCATTCTGCCGAGCTAATCGAACAATATTGTAAAGCTAATAATTTG AGATTACCCCAGATTGGTTACACCTCACGTTTAATTAGGACCCAACAGACCATAGAAACG ATGTGTGAAGAATTTAAGTTAAAGCCACAACTGCAGGTTGTTTACGACTTTAATAAAATC AAACTTGGAGACGAATTTGGCAGTGATGACAAGGATAATATGAAAATCCCGATTCTTCAA ACTTGGAGGCTAAATGAACGTCATTACGGTTCCTGGCAGGGCCAGAGGAAACCGAATGTT TTAAAAGAATATGGTAAGGATAAATATATGTTCATTAGGAGAGATTACGAGGGTAAGCCA CCACCTGTAGATCTTGACCGTGAGATGATTCAACAAGAAAATGAGAAGGGCTCTTCTACT GGGTACGAATTCAAGGAGCCAAACAGACAAATAAAATATGAATTGGAATGCAGCAATCAT GACATTGTATTACCGGATTCCGAATCTCTTCGTGAAGTGGTTTATAGATTGAATCCTTTT CTACAAAATGTCATATTAAAATTAGCCAATCAATATGATGAATCTTCATGCCTGATTGTG GGCCATGGAAGTTCAGTGAGATCGCTACTGAAAATTCTGGAGGGTATATCAGATGATGAC ATCAAGAATGTTGATATTCCAAATGGTATCCCCTTAGTCGTTGAATTAGATAAGAATAAT GGTCTTAAGTTTATCAGAAAATTCTACCTAGATCCTGAATCTGCTAAGATCAATGCTGAG AAAGTCCGTAATGAGGGTTTCATAAAAAATCCTTAA
Protein Properties
Pfam Domain Function
Protein Residues311
Protein Molecular Weight36072.80078
Protein Theoretical pI6.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoglycerate mutase 2 MTASTPSNVMTLFLLRHGQSELNHENIFCGWIDAKLTEKGKEQARHSAELIEQYCKANNL RLPQIGYTSRLIRTQQTIETMCEEFKLKPQLQVVYDFNKIKLGDEFGSDDKDNMKIPILQ TWRLNERHYGSWQGQRKPNVLKEYGKDKYMFIRRDYEGKPPPVDLDREMIQQENEKGSST GYEFKEPNRQIKYELECSNHDIVLPDSESLREVVYRLNPFLQNVILKLANQYDESSCLIV GHGSSVRSLLKILEGISDDDIKNVDIPNGIPLVVELDKNNGLKFIRKFYLDPESAKINAE KVRNEGFIKNP
References
External Links
ResourceLink
Saccharomyces Genome Database GPM2
Uniprot IDQ12008
Uniprot NamePMG2_YEAST
GenBank Gene IDAY692876
Genebank Protein ID51013203
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Heinisch, J. J., Muller, S., Schluter, E., Jacoby, J., Rodicio, R. (1998). "Investigation of two yeast genes encoding putative isoenzymes of phosphoglycerate mutase." Yeast 14:203-213.9544241
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956