You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameArginine biosynthesis bifunctional protein ArgJ, mitochondrial
Synonyms
  • Extracellular mutant protein 40
  • Glutamate N-acetyltransferase
  • GAT
  • Ornithine acetyltransferase
  • OATase
  • Ornithine transacetylase
  • Amino-acid acetyltransferase
  • N-acetylglutamate synthase
  • AGS
  • Arginine biosynthesis bifunctional protein ArgJ alpha chain
  • Arginine biosynthesis bifunctional protein ArgJ beta chain
Gene NameARG7
Enzyme Class
Biological Properties
General FunctionInvolved in glutamate N-acetyltransferase activity
Specific FunctionCatalyzes two activities which are involved in the cyclic version of arginine biosynthesis:the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB ReactionsNot Available
KEGG Reactions
Acetyl-CoA + L-Glutamic acidN-acetyl-L-glutamic acid + hydron + Coenzyme A
L-Glutamic acid + N-AcetylornithineN-acetyl-L-glutamic acid + Ornithine
Metabolites
YMDB IDNameView
YMDB00028N-AcetylornithineShow
YMDB00045Coenzyme AShow
YMDB00066N-acetyl-L-glutamic acidShow
YMDB00271L-Glutamic acidShow
YMDB00312Acetyl-CoAShow
YMDB00353OrnithineShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups other than amino-acyl groups
catalytic activity
acyltransferase activity
transferase activity
acetyl-CoA:L-glutamate N-acetyltransferase activity
acetyltransferase activity
N-acetyltransferase activity
glutamate N-acetyltransferase activity
transferase activity, transferring acyl groups
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
arginine biosynthetic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
arginine metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR062C
Gene Sequence>1326 bp ATGAGAATATCATCAACATTGCTTCAACGCTCGAAGCAGCTTATAGATAAGTATGCATTA TACGTGCCCAAGACGGGCTCTTTTCCTAAAGGATTTGAAGTAGGCTACACTGCATCTGGA GTCAAAAAAAACGGGAGCCTGGACCTGGGTGTAATCTTGAATACCAATAAATCTCGTCCT TCAACCGCAGCAGCTGTTTTCACGACCAATAAATTCAAAGCTGCGCCAGTTTTGACATCG AAAAAAGTCCTTGAAACTGCTCGTGGTAAAAACATCAACGCTATTGTAGTCAATTCCGGT TGTGCTAACTCGGTCACAGGTGATCTTGGTATGAAAGATGCCCAAGTAATGATTGATTTG GTTAACGATAAAATTGGTCAAAAAAATTCTACCCTAGTCATGTCTACAGGCGTTATTGGA CAACGACTACAGATGGACAAGATCAGCACTGGTATCAATAAAATTTTTGGAGAAGAAAAG TTCGGCAGTGATTTTAACTCTTGGTTGAACGTAGCCAAATCAATCTGTACTACTGATACT TTCCCAAAATTAGTTACATCTAGATTCAAATTACCTAGTGGTACTGAGTATACTTTGACA GGTATGGCAAAGGGCGCGGGTATGATTTGTCCGAATATGGCTACCTTATTAGGTTTCATA GTTACAGATCTTCCTATTGAAAGCAAGGCGTTGCAGAAGATGCTGACTTTCGCTACTACC CGTTCATTTAATTGTATATCGGTGGACGGTGATATGAGCACCAATGACACAATTTGCATG TTGGCCAACGGTGCTATTGACACCAAAGAAATTAACGAAGACTCTAAAGATTTTGAACAA GTAAAATTGCAGGTCACAGAATTTGCTCAGCGCTTGGCCCAGTTAGTCGTTCGCGATGGT GAAGGTTCGACAAAGTTTGTTACTGTTAACGTTAAAAATGCTTTGCATTTTGAAGACGCC AAAATAATTGCTGAATCAATCTCAAACTCTATGTTGGTCAAAACCGCACTATATGGGCAA GATGCCAATTGGGGAAGAATATTGTGCGCGATCGGGTATGCAAAGCTGAATGACTTAAAA TCTCTAGATGTCAACAAAATTAATGTTAGCTTTATTGCTACCGACAATTCAGAACCTCGT GAGCTGAAGCTTGTCGCTAATGGTGTGCCACAATTGGAGATCGATGAAACAAGGGCTTCT GAAATATTGGCTTTGAATGATTTGGAAGTGTCTGTCGACTTGGGAACCGGTGATCAGGCA GCACAATTTTGGACTTGTGATTTATCACATGAATATGTAACAATTAACGGTGATTACCGT TCATAA
Protein Properties
Pfam Domain Function
Protein Residues441
Protein Molecular Weight47848.30078
Protein Theoretical pI7.18
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Arginine biosynthesis bifunctional protein ArgJ, mitochondrial MRISSTLLQRSKQLIDKYALYVPKTGSFPKGFEVGYTASGVKKNGSLDLGVILNTNKSRP STAAAVFTTNKFKAAPVLTSKKVLETARGKNINAIVVNSGCANSVTGDLGMKDAQVMIDL VNDKIGQKNSTLVMSTGVIGQRLQMDKISTGINKIFGEEKFGSDFNSWLNVAKSICTTDT FPKLVTSRFKLPSGTEYTLTGMAKGAGMICPNMATLLGFIVTDLPIESKALQKMLTFATT RSFNCISVDGDMSTNDTICMLANGAIDTKEINEDSKDFEQVKLQVTEFAQRLAQLVVRDG EGSTKFVTVNVKNALHFEDAKIIAESISNSMLVKTALYGQDANWGRILCAIGYAKLNDLK SLDVNKINVSFIATDNSEPRELKLVANGVPQLEIDETRASEILALNDLEVSVDLGTGDQA AQFWTCDLSHEYVTINGDYRS
References
External Links
ResourceLink
Saccharomyces Genome Database ARG7
Uniprot IDQ04728
Uniprot NameARGJ_YEAST
GenBank Gene IDU90438
Genebank Protein ID1895091
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Liu, Y., Van Heeswijck, R., Hoj, P., Hoogenraad, N. (1995). "Purification and characterization of ornithine acetyltransferase from Saccharomyces cerevisiae." Eur J Biochem 228:291-296.7705341
  • Crabeel, M., Abadjieva, A., Hilven, P., Desimpelaere, J., Soetens, O. (1997). "Characterization of the Saccharomyces cerevisiae ARG7 gene encoding ornithine acetyltransferase, an enzyme also endowed with acetylglutamate synthase activity." Eur J Biochem 250:232-241.9428669
  • Abadjieva, A., Hilven, P., Pauwels, K., Crabeel, M. (2000). "The yeast ARG7 gene product is autoproteolyzed to two subunit peptides, yielding active ornithine acetyltransferase." J Biol Chem 275:11361-11367.10753950
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Takahara, K., Akashi, K., Yokota, A. (2007). "Continuous spectrophotometric assays for three regulatory enzymes of the arginine biosynthetic pathway." Anal Biochem 368:138-147.17651682