Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative cystathionine gamma-synthase YML082W
Synonyms
  • O-succinylhomoserine (thiol)-lyase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal phosphate binding
Specific FunctionO(4)-succinyl-L-homoserine + L-cysteine = L- cystathionine + succinate
Cellular LocationNot Available
SMPDB Pathways
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB ReactionsNot Available
KEGG Reactions
L-Cysteine + O-Acetyl-L-homoserineAcetic acid + L-Cystathionine + hydron
O-Succinyl-L-homoserine + waterhydron + Ammonium + 2-Ketobutyric acid + Succinic acid
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00056Acetic acidShow
YMDB000712-Ketobutyric acidShow
YMDB00158O-Acetyl-L-homoserineShow
YMDB00245L-CystathionineShow
YMDB00338Succinic acidShow
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00917O-Succinyl-L-homoserineShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
cofactor binding
pyridoxal phosphate binding
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYML082W
Gene Sequence>1950 bp ATGGTTTCAGCGCAAGTGGCTACCGAGCTAGGACAGCCTATACCACTGGACACTCAACAT GCGGTATCTGTATGTTTCCCGACATGGAAATCTGTAATTTCGTATGTGGAGAAAGACCCC AAAGTTTTAGGGTGTTTAAAGTCTGGCTACCCCAGGTTTTGGATCCACCCCTCGATTCAA AAGCTGCGTGATATTTTAATAGAAAAGTATGCTAAAGAAAACGAAACGTGCTTTTGCTTC CCCTCTTATAGAGTTGCCAAACGGTGCAGAGAGTATGTAAGAAGGAAGTGCGCGCATCGC AATGGCAAAGTAAGGATATTACAGTTAGCCACGGCGAAACCTATCAACGAGGAGCAGAAG ACGTGGAAAAGAGAGTGTAAGATTGCGGTAGTGTTTGTAGATGGGGCATACGAGAATATA TTAAAACAGTATTGGCAATACACCGGAGAGATCATCTCAAGCAGACTAGCTGAATATGTT TTGCATGAACTTTTCATGGTAGAAAAGAAATCCAGCCCTGCAGAGGAAAAGGAATACATA GAGATGCGGTATGGCAGGAATCTGAATTTTGCATTTGCCGATCGAGCCAAGGAATTGATT AAGAAGAGGATCGCTACAAAGGTTATAGATAAAGATGAGCACGATGAGGAGGAAAACTAC CATTTCTTAGCAGGTAACCAAGATGAACAGGACTTCCAGGACACGTTTCTGGATTCATCC CTCAATGAGGCTAACCACGGAGAAGATCATGACGGCGGGATTAGCGGTGAAGTAGACAGT CAAGAAGAACCGCATAATGGCCTTGTTTCCACTATACCCCCGGAGCCCATCGAAATGAGC ACGATAGAGGAAGAGCAATCCGTAGAGGAAGATGCCGGGAGGTGTGCATTAAGGGTTTGC CCTGAGAGAGACGTTTTTTTGTTTCCGAGCGGCATGGCGTCGATATTCACTGCGCATAGA TTGCTGTTGCAATGGGACTCACTGCGTTTGAATAGATCCAGAAATGGAAGCGACGTCACC TCGTCACCTCCGAATAAGAAGACCGTGATTTTTGGGTTCCCTTATGCGGATACATTACAT GTCTTGCAAGAGTTTAATGAAACGTATTTCTTGGGAGAAGGAGATGAGTCTTCAATGAAA GAACTAACAAAAATTTTACATTCCGGGGAGCAAATTCTTGCCGTTTTTATAGAGACCCCA TCAAACCCACTATTAAAAATGGGAAATTTACTGGAACTGAAAAGGCTTTCGGAATTATTT GGGTTTTTCATTATCATTGATGAAACTGTGGGTGGAATAGTTAATATTGACGGTCTACCG TTTGCTGATATCGTTTGCAGTTCATTGACGAAGACATTTAGTGGGGACTCTAACGTCATT GGTGGTTCAATGGTTTTAAATCCACAAAGCCGGGTATACGAGTTTGCCTCCCGTTTTATG CAATTAGAAGACGAATATGAAGATTTATTATGGTGCGAAGACGCAATTTACCTGGAAAGA AATTCCAGAGATTTCATTGCTAGAACCATCAGGATCAACTACAGCACCGAATACCTCTTA GATAAAATACTGAAGCCACACGTAGGCGAAAATAAACTATTCAAGAAAATCTACTACCCT AATCTAACCTCAAAAGAAACACTAACCAACTATGACATGGTGAGGTGTAAGAAAGAAGGT GGATACGGCGGGCTCTTTTCACTAACGTTCCATGACGAAGATCATGCTGCGGCCTTTTAT GACAATCTAAAGCTGAACAAGGGTCCTTCCTTGGGCACAAATTTCACACTCGCATTCCCC TATACGCTCATGACATACTACCACGAACTCGACATGGCTGAAAAATTTGGGGTTGAGAGA AATCTTCTCAGAATCAGCGTAGGCCTCGAAAGTCAGTCAATATTGGGCAAGATCTTCCAA GAGGCAATTGATAAAACGGTAGAAATATGA
Protein Properties
Pfam Domain Function
Protein Residues649
Protein Molecular Weight74312.70313
Protein Theoretical pI5.02
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative cystathionine gamma-synthase YML082W MVSAQVATELGQPIPLDTQHAVSVCFPTWKSVISYVEKDPKVLGCLKSGYPRFWIHPSIQ KLRDILIEKYAKENETCFCFPSYRVAKRCREYVRRKCAHRNGKVRILQLATAKPINEEQK TWKRECKIAVVFVDGAYENILKQYWQYTGEIISSRLAEYVLHELFMVEKKSSPAEEKEYI EMRYGRNLNFAFADRAKELIKKRIATKVIDKDEHDEEENYHFLAGNQDEQDFQDTFLDSS LNEANHGEDHDGGISGEVDSQEEPHNGLVSTIPPEPIEMSTIEEEQSVEEDAGRCALRVC PERDVFLFPSGMASIFTAHRLLLQWDSLRLNRSRNGSDVTSSPPNKKTVIFGFPYADTLH VLQEFNETYFLGEGDESSMKELTKILHSGEQILAVFIETPSNPLLKMGNLLELKRLSELF GFFIIIDETVGGIVNIDGLPFADIVCSSLTKTFSGDSNVIGGSMVLNPQSRVYEFASRFM QLEDEYEDLLWCEDAIYLERNSRDFIARTIRINYSTEYLLDKILKPHVGENKLFKKIYYP NLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDEDHAAAFYDNLKLNKGPSLGTNFTLAFP YTLMTYYHELDMAEKFGVERNLLRISVGLESQSILGKIFQEAIDKTVEI
References
External Links
ResourceLink
Saccharomyces Genome Database YML082W
Uniprot IDQ04533
Uniprot NameMETX_YEAST
GenBank Gene IDZ46660
Genebank Protein ID575721
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956