You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative glucokinase-2
Synonyms
  • Early meiotic induction protein 2
  • Glucose kinase 2
  • GLK-2
Gene NameEMI2
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionPutative glucokinase involved in phosphorylation of aldohexoses and glucose uptake. Involved in sporulation. Required for the full activation of the early meiotic inducer IME1
Cellular LocationCytoplasm
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycolysis IPW002386 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
D-Glucose + Adenosine triphosphateGlucose 6-phosphate + ADP
Alpha-D-Glucose + Adenosine triphosphateGlucose 6-phosphate + ADP
Adenosine triphosphate + Beta-D-GlucoseADP + Beta-D-Glucose 6-phosphate
Alpha-D-Glucose + Adenosine triphosphateADP + hydron + Glucose 6-phosphate
Adenosine triphosphate + D-FructoseADP + Beta-D-Fructose 6-phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00146Beta-D-GlucoseShow
YMDB00242Mannose 6-phosphateShow
YMDB00273Alpha-D-GlucoseShow
YMDB00286D-GlucoseShow
YMDB00311Beta-D-Glucose 6-phosphateShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
YMDB00914ADPShow
YMDB00947Glucose 6-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
GO Classification
Component
Not Available
Function
binding
hexokinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
catalytic activity
adenyl ribonucleotide binding
transferase activity
ATP binding
phosphotransferase activity, alcohol group as acceptor
transferase activity, transferring phosphorus-containing groups
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
primary metabolic process
hexose metabolic process
carbohydrate metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR516C
Gene Sequence>1503 bp ATGTCATTTGAAAATTTACATAAAGTCAATGCTGAGGCATTGGAAGATGCAGTGGTTGAG ATCTGCTCCTCATTGCAGGTTGATGCAGCAAAGTTGGACGAACTAACAGCGTACTTCATT GAATGTATGGAAAAGGGGTTGAATAACACCTCTGTAGGCGAAGAAAAGACGGTGGACAAG GGTCTACCCATGATCCCTACATATGTAACCAGTTTGCCCAATGGGACGGAACGTGGTGTT TTGCTGGCTGCAGATTTAGGTGGGACTCACTTCAGAGTGTGTTCTGTGACTTTGAATGGT GACGGAACCTTTGATATGCAGCAATTGAAGTCTAAGATTCCGGAAGAATATCTAAATGAC AAGGATGTCACCAGCGAGGAGCTGTTTAGCTACCTGGGTCGCCGTACAAGGGCCTTCGTT AGGAAGCATCATCCTGAGTTGTTGAAGTCCACGGGGGAGAACATAAAACCTTTGAAAATG GGATTTACCTTCTCATATCCCGTTGACCAAACCTCTTTGAGTTCCGGTACTTTAATCAGA TGGACCAAAAGCTTCAAGATTGAAGACACGGTCGGCAAGGATGTCGTGAGGTTATACCAG GAGCAATTAGACATTCAGGGGCTCTCTATGATTAATGTGGTAGCTTTGACCAACGACACG GTTGGCACTTTCCTATCCCACTGCTACACTTCAGGCTCTCGTCCATCGAGTGCTGGTGAG ATTAGCGAGCCTGTCATTGGTTGTATCTTTGGTACTGGTACTAACGGTTGCTATATGGAG GATATTGAAAACATCAAGAAGCTACCAGATGAGCTCAGAACAAGACTGCTGCATGAAGGA AAAACCCAAATGTGCATCAACATCGAATGGGGTTCTTTCGACAATGAATTGAAACATTTG TCTGCTACAAAGTATGACATCGATATTGACCAAAAATTTTCTCCAAATCCAGGTTACCAT CTATTTGAAAAAAGAATTTCCGGCATGTACTTGGGTGAGCTGTTAAGGAACATCCTGGTG GACTTGCATGCAAGGGGCTTAATCTTGGGACAGTATCGTAATTACGATCAATTACCTCAC CGTTTAAAGACTCCTTTCCAATTGTGCAGTGAAGTTCTTTCCAGGATTGAAATCGATGAT TCGACAAACTTGCGTGAAACTGAATTGTCGTTTTTGCAGAGTTTGAGGCTACCGACCACT TTTGAAGAACGTAAAGCAATTCAAAATCTGGTCCGTTCCATTACGAGAAGGTCTGCATAT CTAGCAGCCGTTCCGATTGCCGCCATCCTAATCAAGACAAACGCTTTGAACAAAAGATAT CACGGTGAGGTAGAAATTGGTTTTGACGGTTATGTCATCGAATACTATCCTGGATTCAGA TCCATGCTGAGACATGCTTTGGCATTAAGTCCAATTGGCACTGAGGGTGAACGTAAGATA CATTTGCGTCTAGCCAAAGATGGGTCCGGTGTTGGCGCAGCTTTGTGTGCTCTGGTGGCA TAA
Protein Properties
Pfam Domain Function
Protein Residues500
Protein Molecular Weight55920.30078
Protein Theoretical pI6.21
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative glucokinase-2 MSFENLHKVNAEALEDAVVEICSSLQVDAAKLDELTAYFIECMEKGLNNTSVGEEKTVDK GLPMIPTYVTSLPNGTERGVLLAADLGGTHFRVCSVTLNGDGTFDMQQLKSKIPEEYLND KDVTSEELFSYLGRRTRAFVRKHHPELLKSTGENIKPLKMGFTFSYPVDQTSLSSGTLIR WTKSFKIEDTVGKDVVRLYQEQLDIQGLSMINVVALTNDTVGTFLSHCYTSGSRPSSAGE ISEPVIGCIFGTGTNGCYMEDIENIKKLPDELRTRLLHEGKTQMCINIEWGSFDNELKHL SATKYDIDIDQKFSPNPGYHLFEKRISGMYLGELLRNILVDLHARGLILGQYRNYDQLPH RLKTPFQLCSEVLSRIEIDDSTNLRETELSFLQSLRLPTTFEERKAIQNLVRSITRRSAY LAAVPIAAILIKTNALNKRYHGEVEIGFDGYVIEYYPGFRSMLRHALALSPIGTEGERKI HLRLAKDGSGVGAALCALVA
References
External Links
ResourceLink
Saccharomyces Genome Database EMI2
Uniprot IDQ04409
Uniprot NameEMI2_YEAST
GenBank Gene IDU33057
Genebank Protein ID927785
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Lutfiyya, L. L., Iyer, V. R., DeRisi, J., DeVit, M. J., Brown, P. O., Johnston, M. (1998). "Characterization of three related glucose repressors and genes they regulate in Saccharomyces cerevisiae." Genetics 150:1377-1391.9832517
  • Enyenihi, A. H., Saunders, W. S. (2003). "Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae." Genetics 163:47-54.12586695
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956