You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGamma-glutamyl phosphate reductase
Synonyms
  • GPR
  • Glutamate-5-semialdehyde dehydrogenase
  • GSA dehydrogenase
  • Glutamyl-gamma-semialdehyde dehydrogenase
Gene NamePRO2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the NADPH dependent reduction of L-gamma- glutamyl 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclization to form 1-pyrroline-5-carboxylate
Cellular LocationNot Available
SMPDB Pathways
Proline MetabolismPW002365 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB Reactions
L-Glutamic acid 5-phosphate + hydron + NADPHl-Glutamic-gamma-semialdehyde + NADP + phosphate
KEGG Reactions
L-Glutamic acid 5-phosphate + NADPH + hydronNADP + phosphate + l-Glutamic-gamma-semialdehyde
NADH + L-Glutamic acid 5-phosphate + hydronNAD + phosphate + l-Glutamic-gamma-semialdehyde
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00233L-Glutamic acid 5-phosphateShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00918l-Glutamic-gamma-semialdehydeShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the aldehyde or oxo group of donors
oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
glutamate-5-semialdehyde dehydrogenase activity
catalytic activity
binding
nucleotide binding
oxidoreductase activity
NADP or NADPH binding
Process
proline metabolic process
proline biosynthetic process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 15
LocusYOR323C
Gene Sequence>1371 bp ATGTCCAGTTCACAACAAATAGCCAAAAATGCCCGTAAAGCAGGGAATATTTTGAAAACC ATCTCAAACGAGGGCAGATCAGATATTTTATACAAAATTCACGATGCCCTGAAGGCTAAT GCGCATGCCATTGAAGAAGCGAATAAAATCGATTTAGCTGTTGCCAAAGAGACTGGCCTA GCGGATTCTTTATTGAAACGTCTCGACCTATTTAAAGGGGACAAATTTGAAGTTATGTTA CAAGGTATTAAGGATGTAGCCGAACTAGAAGACCCTGTTGGCAAGGTTAAAATGGCCAGG GAATTAGATGATGGCTTGACGTTGTACCAAGTAACCGCTCCAGTCGGCGTTTTGTTAGTT ATCTTTGAATCCCGTCCAGAAGTTATTGCCAATATTACCGCATTGAGTATCAAGTCTGGT AATGCTGCAATTTTGAAGGGTGGTAAAGAGTCTGTGAACACGTTCAGAGAAATGGCAAAG ATCGTTAACGACACCATTGCACAATTCCAAAGTGAGACTGGTGTTCCTGTGGGCTCTGTG CAATTGATCGAAACCAGACAGGATGTTTCCGACTTGTTGGATCAAGATGAGTACATCGAC TTAGTTGTTCCTCGTGGTTCCAATGCCTTAGTCAGAAAAATCAAGGACACTACAAAAATT CCCGTGTTGGGTCATGCGGATGGTATCTGCTCAATTTACTTGGATGAAGACGCAGATTTG ATTAAGGCAAAAAGAATTAGTTTGGATGCAAAGACTAACTACCCAGCTGGTTGCAACGCT ATGGAAACGTTGTTGATTAACCCAAAATTCTCTAAGTGGTGGGAAGTTCTGGAAAACTTA ACTTTGGAAGGCGGAGTGACTATCCACGCTACAAAAGATTTGAAAACTGCGTATTTTGAT AAACTGAATGAGTTAGGGAAATTGACAGAAGCAATTCAATGCAAAACCGTTGATGCTGAT GAGGAGCAAGATTTTGATAAGGAATTTTTATCCTTGGATTTGGCTGCCAAGTTTGTTACA TCTACAGAATCGGCCATTCAACATATAAATACACACTCTTCGAGACATACCGACGCTATT GTAACGGAAAATAAAGCAAACGCTGAAAAATTTATGAAGGGTGTCGACTCCTCTGGTGTT TACTGGAATGCATCAACTAGATTTGCCGATGGTTTCAGGTACGGTTTTGGTGCTGAAGTG GGTATTTCTACCTCTAAGATTCACGCCCGTGGTCCAGTTGGCTTGGACGGTCTGGTGAGT TATCAATACCAAATAAGAGGTGACGGCCAGGTTGCTAGTGACTACCTTGGTGCTGGTGGT AACAAAGCTTTTGTTCACAAGGATTTAGATATAAAGACTGTGACATTATAA
Protein Properties
Pfam Domain Function
Protein Residues456
Protein Molecular Weight49740.0
Protein Theoretical pI5.25
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Gamma-glutamyl phosphate reductase MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS YQYQIRGDGQVASDYLGAGGNKAFVHKDLDIKTVTL
References
External Links
ResourceLink
Saccharomyces Genome Database PRO2
Uniprot IDP54885
Uniprot NamePROA_YEAST
GenBank Gene IDAY692984
Genebank Protein ID51013419
PDB ID
1VLU
General Reference
  • Pearson, B. M., Hernando, Y., Payne, J., Wolf, S. S., Kalogeropoulos, A., Schweizer, M. (1996). "Sequencing of a 35.71 kb DNA segment on the right arm of yeast chromosome XV reveals regions of similarity to chromosomes I and XIII." Yeast 12:1021-1031.8896266
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106