You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexose transporter HXT11
Synonyms
  • Low-affinity glucose transporter LGT3
Gene NameHXT11
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionProbable glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00072D-GalactoseShow
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
membrane
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 15
LocusYOL156W
Gene Sequence>1704 bp ATGTCAGGTGTTAATAATACATCCGCAAATGAGTTATCTACTACCATGTCTAACTCTAAC TCAGCAGTAGGCGCTCCCTCTGTTAAGACTGAACACGGTGACTCTAAAAATTCCCTTAAC CTAGATGCCAATGAGCCACCTATTGACTTACCTCAAAAACCCCTCTCTGCGTATACCACC GTCGCAATCCTGTGTTTGATGATTGCATTTGGCGGCTTCATCTTTGGTTGGGATACCGGT ACCATTTCTGGTTTTGTTAACCTTTCTGATTTCATCAGAAGGTTCGGTCAAAAAAATGAC AAGGGAACCTACTACTTATCGAAAGTAAGAATGGGTTTGATCGTCTCAATATTCAACATT GGCTGCGCCATAGGCGGAATTGTCTTGTCAAAAGTCGGTGATATATATGGTCGTCGTATT GGATTGATTACAGTTACTGCCATTTACGTTGTAGGCATCCTAATCCAAATAACTTCCATA AACAAGTGGTACCAATACTTCATTGGAAGAATTATTTCTGGCCTAGGAGTGGGAGGCATT GCTGTCCTTTCCCCAATGTTGATATCTGAAGTTGCTCCCAAACATATCAGAGGAACTCTG GTCCAATTGTACCAGCTGATGGGTACGATGGGTATTTTTCTAGGATACTGTACCAATTAC GGTACCAAGAACTATCACAACGCCACTCAATGGAGAGTCGGCCTTGGTCTTTGCTTTGCC TGGGCTACATTCATGGTTAGTGGAATGATGTTTGTACCAGAATCACCACGTTACCTGATT GAGGTTGGTAAAGATGAGGAAGCGAAACGTTCACTATCGAAATCCAACAAAGTCTCAGTT GACGATCCAGCCTTGCTAGTTGAATATGACACTATAAAGGCAGGAATTGAACTTGAAAAG CTGGCAGGTAACGCATCATGGTCTGAACTACTCTCCACTAAAACAAAGGTCTTTCAGCGT GTTCTCATGGGAGTGATGATCCAATCGCTGCAGCAATTAACCGGTGACAACTACTTCTTT TACTACGGTACCACCATCTTCAAATCTGTCGGTCTAAAGGACTCCTTTCAGACTTCGATC ATTATCGGTGTGGTTAATTTTTTCTCTTCATTCATAGCGGTATACACCATTGAGAGGTTT GGACGCCGTACGTGTCTATTGTGGGGTGCTGCTTCTATGCTATGCTGCTTTGCTGTGTTT GCCTCCGTCGGTGTGACAAAGTTGTGGCCTCAAGGAAGCAGTCACCAAGACATTACTTCT CAGGGCGCCGGTAACTGTATGATTGTGTTTACTATGTTCTTCATTTTTTCGTTCGCCACC ACTTGGGCAGGCGGCTGTTACGTTATTGTCTCAGAGACGTTTCCTCTTAGGGTCAAATCA AGAGGAATGGCAATCGCAACAGCTGCAAACTGGATGTGGGGTTTCCTGATTAGTTTCTTT ACCCCATTCATTACCGGGGCAATCAACTTTTACTACGGTTACGTATTCTTAGGCTGTCTG GTTTTTGCATACTTTTATGTCTTTTTCTTTGTCCCAGAAACAAAAGGCCTGACACTGGAG GAGGTGAATACTATGTGGCTGGAAGGTGTGCCAGCATGGAAATCGGCCTCATGGGTGCCA CCGGAGAGAAGAACCGCAGATTACGATGCTGATGCAATAGATCATGACAATAGACCAATT TACAAGAGGTTCTTTTCCAGCTGA
Protein Properties
Pfam Domain Function
Protein Residues567
Protein Molecular Weight62732.19922
Protein Theoretical pI8.6
Signalling Regions
  • None
Transmembrane Regions
  • 57-77
  • 113-133
  • 140-160
  • 171-191
  • 198-218
  • 233-253
  • 337-353
  • 360-377
  • 385-405
  • 430-450
  • 468-488
  • 490-510
Protein Sequence>Hexose transporter HXT11 MSGVNNTSANELSTTMSNSNSAVGAPSVKTEHGDSKNSLNLDANEPPIDLPQKPLSAYTT VAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNI GCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGI AVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFA WATFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLVEYDTIKAGIELEK LAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSI IIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITS QGAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFF TPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVP PERRTADYDADAIDHDNRPIYKRFFSS
References
External Links
ResourceLink
Saccharomyces Genome Database HXT11
Uniprot IDP54862
Uniprot NameHXT11_YEAST
GenBank Gene IDX82621
Genebank Protein ID575724
General Reference
  • Gamo, F. J., Lafuente, M. J., Casamayor, A., Arino, J., Aldea, M., Casas, C., Herrero, E., Gancedo, C. (1996). "Analysis of the DNA sequence of a 15,500 bp fragment near the left telomere of chromosome XV from Saccharomyces cerevisiae reveals a putative sugar transporter, a carboxypeptidase homologue and two new open reading frames." Yeast 12:709-714.8810044
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258