Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAromatic amino acid aminotransferase 1
Synonyms
  • Aromatic amino acid aminotransferase I
  • Aromatic amino acid-requiring protein 8
Gene NameARO8
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring nitrogenous groups
Specific FunctionHas aromatic amino acid transaminase activity. Also active with methionine, alpha-aminoadipate and leucine when phenylpyruvate is the amino acceptor
Cellular LocationCytoplasm
SMPDB Pathways
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Lysine biosynthesisec00300 Map00300
Phenylalanine metabolismec00360 Map00360
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
keto-phenylpyruvic acid + L-Glutamic acidL-Phenylalanine + Oxoglutaric acid
(4-hydroxyphenyl)pyruvic acid + L-Glutamic acidOxoglutaric acid + L-Tyrosine
L-Tryptophan + Oxoglutaric acidL-Glutamic acid + 3-(indol-3-yl)pyruvate
KEGG Reactions
Oxoglutaric acid + L-PhenylalanineL-Glutamic acid + keto-phenylpyruvic acid
Oxoglutaric acid + L-TryptophanL-Glutamic acid + 3-(indol-3-yl)pyruvic acid
L-Glutamic acid + (4-hydroxyphenyl)pyruvic acidL-Tyrosine + Oxoglutaric acid
Metabolites
YMDB IDNameView
YMDB00126L-TryptophanShow
YMDB00142Oxoadipic acidShow
YMDB00153Oxoglutaric acidShow
YMDB001693-(indol-3-yl)pyruvic acidShow
YMDB00271L-Glutamic acidShow
YMDB00304L-PhenylalanineShow
YMDB00364L-TyrosineShow
YMDB00786keto-phenylpyruvic acidShow
YMDB00958(4-hydroxyphenyl)pyruvic acidShow
YMDB00999L-2-aminoadipateShow
YMDB010693-(indol-3-yl)pyruvateShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
binding
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
Process
metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL202W
Gene Sequence>1503 bp ATGACTTTACCTGAATCAAAAGACTTTTCTTACTTGTTTTCGGATGAAACCAATGCTCGT AAACCATCCCCATTGAAAACCTGCATCCATCTTTTCCAAGATCCTAACATTATCTTTTTG GGTGGTGGCCTGCCATTAAAAGATTATTTCCCATGGGATAATCTATCTGTAGATTCACCC AAGCCTCCTTTTCCCCAGGGTATTGGAGCTCCAATTGACGAGCAGAATTGCATAAAATAC ACCGTCAACAAAGATTACGCTGATAAAAGTGCCAATCCTTCCAACGATATTCCTTTGTCA AGAGCTTTGCAATACGGGTTCAGTGCTGGTCAACCTGAACTATTAAACTTCATTAGAGAT CATACCAAGATTATCCACGATTTGAAGTATAAGGACTGGGACGTTTTAGCCACTGCAGGT AACACAAATGCCTGGGAATCTACTTTAAGAGTCTTTTGTAACCGAGGTGATGTCATCTTA GTTGAGGCACATTCTTTTTCCTCTTCATTGGCTTCTGCAGAGGCTCAAGGTGTCATTACC TTCCCCGTGCCAATTGACGCTGATGGTATCATTCCTGAAAAATTAGCTAAAGTCATGGAA AACTGGACACCTGGTGCTCCTAAACCAAAGTTGTTATACACTATTCCAACGGGCCAAAAT CCAACTGGTACTTCCATTGCAGACCATAGAAAGGAGGCAATTTACAAGATCGCTCAAAAG TACGACTTCCTAATTGTGGAAGATGAACCTTATTATTTCTTACAAATGAATCCCTACATC AAAGACTTGAAGGAAAGAGAGAAGGCACAAAGTTCTCCAAAGCAGGACCATGACGAATTT TTGAAGTCCTTGGCAAACACTTTCCTTTCCTTGGATACAGAAGGCCGTGTTATTAGAATG GATTCCTTTTCAAAAGTTTTGGCCCCAGGGACAAGATTGGGTTGGATTACTGGTTCATCC AAAATCTTGAAGCCTTACTTGAGTTTGCATGAAATGACGATTCAAGCCCCAGCAGGTTTT ACACAAGTTTTGGTCAACGCTACGCTATCCAGGTGGGGTCAAAAGGGTTACTTGGACTGG TTGCTTGGCCTGCGTCATGAATACACTTTGAAACGTGACTGTGCCATCGATGCCCTTTAC AAGTATCTACCACAATCTGATGCTTTCGTGATCAATCCTCCAATTGCAGGTATGTTTTTC ACCGTGAACATTGACGCATCTGTCCACCCTGAGTTTAAAACAAAATACAACTCAGACCCT TACCAGCTAGAACAGAGTCTTTACCACAAAGTGGTTGAACGTGGTGTTTTAGTGGTTCCC GGTTCTTGGTTCAAGAGTGAGGGTGAGACGGAACCTCCTCAACCCGCTGAATCTAAAGAA GTCAGTAATCCAAACATAATTTTCTTCAGAGGTACCTATGCAGCTGTCTCTCCTGAGAAA CTGACTGAAGGTCTGAAGAGATTAGGTGATACTTTATACGAAGAATTTGGTATTTCCAAA TAG
Protein Properties
Pfam Domain Function
Protein Residues500
Protein Molecular Weight56177.30078
Protein Theoretical pI5.86
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aromatic amino acid aminotransferase 1 MTLPESKDFSYLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLKDYFPWDNLSVDSP KPPFPQGIGAPIDEQNCIKYTVNKDYADKSANPSNDIPLSRALQYGFSAGQPELLNFIRD HTKIIHDLKYKDWDVLATAGNTNAWESTLRVFCNRGDVILVEAHSFSSSLASAEAQGVIT FPVPIDADGIIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQK YDFLIVEDEPYYFLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTEGRVIRM DSFSKVLAPGTRLGWITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLSRWGQKGYLDW LLGLRHEYTLKRDCAIDALYKYLPQSDAFVINPPIAGMFFTVNIDASVHPEFKTKYNSDP YQLEQSLYHKVVERGVLVVPGSWFKSEGETEPPQPAESKEVSNPNIIFFRGTYAAVSPEK LTEGLKRLGDTLYEEFGISK
References
External Links
ResourceLink
Saccharomyces Genome Database ARO8
Uniprot IDP53090
Uniprot NameARO8_YEAST
GenBank Gene IDAY692962
Genebank Protein ID51013375
General Reference
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • King, R. D., Rowland, J., Oliver, S. G., Young, M., Aubrey, W., Byrne, E., Liakata, M., Markham, M., Pir, P., Soldatova, L. N., Sparkes, A., Whelan, K. E., Clare, A. (2009). "The automation of science." Science 324:85-89.19342587
  • Urrestarazu, A., Vissers, S., Iraqui, I., Grenson, M. (1998). "Phenylalanine- and tyrosine-auxotrophic mutants of Saccharomyces cerevisiae impaired in transamination." Mol Gen Genet 257:230-237.9491082
  • Iraqui, I., Vissers, S., Cartiaux, M., Urrestarazu, A. (1998). "Characterisation of Saccharomyces cerevisiae ARO8 and ARO9 genes encoding aromatic aminotransferases I and II reveals a new aminotransferase subfamily." Mol Gen Genet 257:238-248.9491083
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956