You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNicotinate-nucleotide pyrophosphorylase [carboxylating]
Synonyms
  • Quinolinate phosphoribosyltransferase [decarboxylating]
  • QAPRTase
Gene NameBNA6
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInvolved in the catabolism of quinolinic acid (QA)
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB Reactions
Quinolinic acid + hydron + Phosphoribosyl pyrophosphatePyrophosphate + Carbon dioxide + Nicotinic acid mononucleotide
KEGG Reactions
Quinolinic acid + Phosphoribosyl pyrophosphate + hydronPyrophosphate + Carbon dioxide + Nicotinic acid mononucleotide
Metabolites
YMDB IDNameView
YMDB00007Quinolinic acidShow
YMDB00193Nicotinic acid mononucleotideShow
YMDB00219PyrophosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00741nicotinic acid D-ribonucleotideShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
nicotinate-nucleotide diphosphorylase (carboxylating) activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring pentosyl groups
Process
metabolic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
pyridine nucleotide biosynthetic process
nicotinamide nucleotide biosynthetic process
NAD biosynthetic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFR047C
Gene Sequence>gi|330443543:c245166-244279 Saccharomyces cerevisiae S288c chromosome VI, complete sequence ATGCCTGTTTATGAACACTTATTGCCCGTTAATGGAGCATGGAGACAAGACGTCACCAAT TGGCTGAGCGAGGACGTTCCTTCTTTTGATTTTGGTGGATATGTTGTTGGTTCCGACCTA AAGGAGGCCAATTTGTACTGTAAGCAGGATGGTATGCTGTGTGGTGTCCCCTTTGCGCAA GAAGTCTTTAATCAGTGCGAATTGCAAGTTGAGTGGTTGTTTAAGGAAGGCTCCTTCTTG GAGCCTTCGAAGAATGACTCTGGTAAGATTGTTGTAGCTAAAATTACTGGGCCCGCTAAA AACATTCTATTAGCTGAAAGAACCGCCTTGAACATCCTTAGTAGAAGTAGTGGAATTGCC ACCGCCTCACATAAGATAATCAGTTTGGCGCGTTCGACTGGTTACAAGGGGACCATTGCG GGGACAAGAAAGACTACACCAGGTTTACGTAGATTAGAAAAGTATTCCATGCTTGTAGGT GGCTGCGACACGCACAGATACGACCTTTCCTCTATGGTCATGCTCAAAGATAATCATATT TGGGCTACTGGTTCTATAACAAACGCAGTTAAGAACGCCAGGGCCGTGTGCGGGTTTGCT GTGAAGATCGAAGTGGAGTGTTTGAGTGAAGATGAAGCCACAGAGGCCATTGAAGCTGGT GCAGACGTTATCATGTTGGATAATTTCAAAGGTGACGGTTTGAAAATGTGCGCCCAAAGT CTTAAGAACAAATGGAATGGTAAAAAGCATTTCCTCTTGGAATGTAGTGGAGGCTTGAAT TTGGACAACCTCGAGGAGTATTTGTGCGATGACATTGACATTTACAGCACTAGTAGCATT CATCAAGGCACACCAGTGATTGATTTCTCATTGAAACTGGCTCATTGA
Protein Properties
Pfam Domain Function
Protein Residues295
Protein Molecular Weight32364.69922
Protein Theoretical pI5.64
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Nicotinate-nucleotide pyrophosphorylase [carboxylating] MPVYEHLLPVNGAWRQDVTNWLSEDVPSFDFGGYVVGSDLKEANLYCKQDGMLCGVPFAQ EVFNQCELQVEWLFKEGSFLEPSKNDSGKIVVAKITGPAKNILLAERTALNILSRSSGIA TASHKIISLARSTGYKGTIAGTRKTTPGLRRLEKYSMLVGGCDTHRYDLSSMVMLKDNHI WATGSITNAVKNARAVCGFAVKIEVECLSEDEATEAIEAGADVIMLDNFKGDGLKMCAQS LKNKWNGKKHFLLECSGGLNLDNLEEYLCDDIDIYSTSSIHQGTPVIDFSLKLAH
References
External Links
ResourceLink
Saccharomyces Genome Database BNA6
Uniprot IDP43619
Uniprot NameNADC_YEAST
General Reference
  • Eki, T., Naitou, M., Hagiwara, H., Ozawa, M., Sasanuma, S. I., Sasanuma, M., Tsuchiya, Y., Shibata, T., Hanaoka, F., Murakami, Y. (1996). "Analysis of a 36.2 kb DNA sequence including the right telomere of chromosome VI from Saccharomyces cerevisiae." Yeast 12:149-167.8686379
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Panozzo, C., Nawara, M., Suski, C., Kucharczyka, R., Skoneczny, M., Becam, A. M., Rytka, J., Herbert, C. J. (2002). "Aerobic and anaerobic NAD+ metabolism in Saccharomyces cerevisiae." FEBS Lett 517:97-102.12062417
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • di Luccio, E., Wilson, D. K. (2008). "Comprehensive X-ray structural studies of the quinolinate phosphoribosyl transferase (BNA6) from Saccharomyces cerevisiae." Biochemistry 47:4039-4050.18321072