You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAmino-acid acetyltransferase, mitochondrial
Synonyms
  • Arginine-requiring protein 2
  • Glutamate N-acetyltransferase
  • N-acetylglutamate synthase
  • AGS
  • NAGS
Gene NameARG2
Enzyme Class
Biological Properties
General FunctionInvolved in arginine biosynthetic process
Specific FunctionN-acetylglutamate synthase involved in arginine biosynthesis
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB ReactionsNot Available
KEGG Reactions
Acetyl-CoA + L-Glutamic acidN-acetyl-L-glutamic acid + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00066N-acetyl-L-glutamic acidShow
YMDB00271L-Glutamic acidShow
YMDB00312Acetyl-CoAShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
Not Available
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
arginine metabolic process
arginine biosynthetic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL071W
Gene Sequence>1725 bp ATGTGGAGGAGAATATTCGCGCATGAACTCAAGTATGATCAACCCAATGCATCTTCAAAA AACTTGATCCTTTCAGTTCTGAATACAACCGCTACAAAACGAGAGGCTAAGGATTATCTC TCAAAATATACAAATGATAGTGGGCAGCATAATCATTGTTTGTTTTTTATCAGGGACCTG CATAAAGTCGCACCAGCGATTTTGTCCCAGTTTTCAAGTGTCATAAAGAGACTAGGAATG CTAGGTTTGCGACCTATGTTTGTAATTCCGCCGTCGCCAACTCATGTAAATATACAGGCA GAGTTACTTGACAGTATCGTTACAGAAGCAGATTTAAAGCCACTTCACCTTAAGGAGGGT CTTACTAAATCCCGCACTGGGTTATATCATTCTGTTTTTTCGCAAGAGAGTCGTTTCTTT GATATTGGAAATTCCAATTTTATACCAATTGTGAAACCTTATGTGTATAATGAAGAGACT GCTTCAGAATTCATGACAAAGGATGTTGTAAAATTTATGGATTGCCTGTGCCAAGGGAAT ATTCCACACATTGACAAATTCTTCATTCTAAATAATGCCGGAGGTATACCTTCGGGAGAG AGAAATGATAACGCTCATGTATTCATCAATCTTTCTCAGGAACTCGAGCATTTGTCCTCG TCATTATCTCACAATATAAGCACTCTAACCAAACGAGAGCCACGCTCCCAAAACCTGTTA CACAGAATGGAGGTGTACGTTAAAAAAGATGAGATATCTTCCTTAGAATGTGAATACCAT GATCATTTAGAAAACCTGTTATTGATGGACAAAGTTTTATCAAATCTAGCGGCTACAGCA ACGGGACTGATTACAACTGTCAAAGCTGCCGCACTATCATCAGATAGGAAAAATCCTTTA GTATATAATTTATTGACAGACCGATCGCTAATTTCTTCTTCTTTACCAAGGTTTAAAAAA AAGGACGGCGAGATAGACTCACCAGCCAACATGTTTGATGATCACGCATGGTATGAATTG CCTTCCCAACAGGTAAATGCAGCTCCTTCTAACTCAGATGCAGTTTTAGTGACAACTGTT CTCAAAAAGGGCGTCCATATCAAAACTTATGACTATAAGACGCTGACTCAATTCAACTCA ATTGGGCTTCCAAAGAAGTTTCACGTACCTGAGAAAGGAGCAAAACCCTCGAGCAATAGT CCAAAACTAGATATCAACAAATTTAAATCCATCATCGATCAGAGCTTTAAAAGATCTTTG GATTTGCATGACTACATAAAAAGGATTAATGGAAAAATAGCTACAATTATTGTGATAGGT GATTATGAAGGCATTGCAATTCTTACCTATGAAGGCTCGGAGGAAAATTCCTTTGTTTAT CTCGATAAGTTCGCCGTTCTACCACACTTGAAAGGCTCGCTGGGTATATCTGATATAATC TTCAATTTGATGTTCAAAAAATTTCCTAATGAGATACTTTGGAGAAGCAGAAAAGACAAT GTGGTGAACAAGTGGTATTTTCAACGTAGCGTTGCTGTGCTAGATTTGTCGATTGACTTA GACCCCGAACACTGTGATGAAAAGCAAAGCCAATTTAAACTATTTTACTACGGTAACCCT CAATACGCTAAGAGGGCACTACGTGACAAGAAACGTTTAAGAGAATTCATGAGGTCTGTC AGGGACATCAAGCCAAGTTGGGAAAATGAAAAAAATATTTCATGA
Protein Properties
Pfam Domain Function
Protein Residues574
Protein Molecular Weight65609.5
Protein Theoretical pI9.26
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Amino-acid acetyltransferase, mitochondrial MWRRIFAHELKYDQPNASSKNLILSVLNTTATKREAKDYLSKYTNDSGQHNHCLFFIRDL HKVAPAILSQFSSVIKRLGMLGLRPMFVIPPSPTHVNIQAELLDSIVTEADLKPLHLKEG LTKSRTGLYHSVFSQESRFFDIGNSNFIPIVKPYVYNEETASEFMTKDVVKFMDCLCQGN IPHIDKFFILNNAGGIPSGERNDNAHVFINLSQELEHLSSSLSHNISTLTKREPRSQNLL HRMEVYVKKDEISSLECEYHDHLENLLLMDKVLSNLAATATGLITTVKAAALSSDRKNPL VYNLLTDRSLISSSLPRFKKKDGEIDSPANMFDDHAWYELPSQQVNAAPSNSDAVLVTTV LKKGVHIKTYDYKTLTQFNSIGLPKKFHVPEKGAKPSSNSPKLDINKFKSIIDQSFKRSL DLHDYIKRINGKIATIIVIGDYEGIAILTYEGSEENSFVYLDKFAVLPHLKGSLGISDII FNLMFKKFPNEILWRSRKDNVVNKWYFQRSVAVLDLSIDLDPEHCDEKQSQFKLFYYGNP QYAKRALRDKKRLREFMRSVRDIKPSWENEKNIS
References
External Links
ResourceLink
Saccharomyces Genome Database ARG2
Uniprot IDP40360
Uniprot NameNAGS_YEAST
GenBank Gene IDX88851
Genebank Protein ID895896
General Reference
  • Vandenbol, M., Durand, P., Dion, C., Portetelle, D., Hilger, F. (1995). "Sequence of a 17.1 kb DNA fragment from chromosome X of Saccharomyces cerevisiae includes the mitochondrial ribosomal protein L8." Yeast 11:57-60.7762302
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Jauniaux, J. C., Urrestarazu, L. A., Wiame, J. M. (1978). "Arginine metabolism in Saccharomyces cerevisiae: subcellular localization of the enzymes." J Bacteriol 133:1096-1107.205532
  • Wipe, B., Leisinger, T. (1979). "Regulation of activity and synthesis of N-acetylglutamate synthase from Saccharomyces cerevisiae." J Bacteriol 140:874-880.391804
  • Abadjieva, A., Pauwels, K., Hilven, P., Crabeel, M. (2001). "A new yeast metabolon involving at least the two first enzymes of arginine biosynthesis: acetylglutamate synthase activity requires complex formation with acetylglutamate kinase." J Biol Chem 276:42869-42880.11553611
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106