You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADP-specific glutamate dehydrogenase 2
Synonyms
  • NADP-GDH 2
  • NADP-dependent glutamate dehydrogenase 2
Gene NameGDH3
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionL-glutamate + H(2)O + NADP(+) = 2-oxoglutarate + NH(3) + NADPH
Cellular LocationNot Available
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
Oxoglutaric acid + Ammonium + NADPH + hydronwater + NADP + L-Glutamic acid
Ammonia + NADPH + hydron + Oxoglutaric acidwater + NADP + L-Glutamic acid
KEGG Reactions
Oxoglutaric acid + NADPH + hydron + AmmoniumNADP + L-Glutamic acid + water
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00423AmmoniumShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
oxidoreductase activity, acting on the CH-NH2 group of donors
oxidoreductase activity
catalytic activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 1
LocusYAL062W
Gene Sequence>1374 bp ATGACAAGCGAACCAGAGTTTCAGCAGGCTTACGATGAGATCGTTTCTTCTGTGGAGGAT TCCAAAATTTTTGAAAAATTCCCACAGTATAAAAAAGTGTTACCTATTGTTTCTGTCCCG GAGAGGATCATTCAATTCAGGGTCACGTGGGAAAATGATAATGGCGAGCAAGAAGTGGCT CAAGGATACAGGGTGCAGTTCAATTCAGCCAAGGGCCCTTACAAGGGTGGCCTACGCTTC CACCCATCAGTGAACCTGTCTATCCTAAAATTTTTGGGTTTTGAACAGATCTTCAAGAAT GCGCTCACTGGGCTAGATATGGGCGGTGGTAAGGGTGGCCTGTGTGTGGACTTGAAAGGC AAGTCTGACAACGAGATCAGAAGGATTTGTTATGCGTTCATGAGAGAACTGAGCAGGCAT ATTGGTAAGGACACAGACGTGCCCGCAGGAGATATTGGTGTCGGTGGCCGTGAAATTGGC TACCTATTCGGCGCTTACAGATCATACAAGAACTCCTGGGAAGGTGTGTTGACTGGTAAG GGTTTAAACTGGGGTGGCTCACTTATCAGGCCGGAGGCCACCGGGTTCGGCTTAGTTTAC TATACGCAAGCAATGATCGATTATGCAACAAACGGCAAGGAGTCGTTTGAGGGCAAACGT GTGACAATCTCCGGAAGTGGCAATGTTGCGCAATATGCAGCTTTGAAAGTGATCGAGCTG GGTGGTATTGTGGTGTCTTTATCCGATTCGAAGGGGTGCATCATCTCTGAGACGGGCATT ACTTCTGAGCAAATTCACGATATCGCTTCCGCCAAGATCCGTTTCAAGTCGTTAGAGGAA ATCGTTGATGAATACTCTACTTTCAGCGAAAGTAAGATGAAGTACGTTGCAGGAGCACGC CCATGGACGCATGTGAGCAACGTCGACATTGCCTTGCCCTGTGCCACCCAAAACGAGGTC AGTGGTGACGAAGCCAAGGCCCTAGTGGCATCTGGCGTTAAGTTCGTTGCCGAAGGTGCT AACATGGGTTCTACACCCGAGGCTATTTCTGTTTTCGAAACAGCGCGTAGCACTGCAACC AATGCAAAGGATGCAGTTTGGTTTGGGCCACCAAAGGCAGCTAACCTGGGCGGCGTGGCA GTATCCGGTCTGGAAATGGCTCAGAATTCTCAAAAAGTAACTTGGACTGCCGAGCGGGTC GATCAAGAACTAAAGAAGATAATGATCAACTGCTTCAACGACTGCATACAGGCCGCACAA GAGTACTCTACGGAAAAAAATACAAACACCTTGCCATCATTGGTCAAGGGGGCCAACATT GCCAGCTTCGTCATGGTGGCTGACGCAATGCTTGACCAGGGAGACGTTTTTTAG
Protein Properties
Pfam Domain Function
Protein Residues457
Protein Molecular Weight49626.80078
Protein Theoretical pI5.12
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADP-specific glutamate dehydrogenase 2 MTSEPEFQQAYDEIVSSVEDSKIFEKFPQYKKVLPIVSVPERIIQFRVTWENDNGEQEVA QGYRVQFNSAKGPYKGGLRFHPSVNLSILKFLGFEQIFKNALTGLDMGGGKGGLCVDLKG KSDNEIRRICYAFMRELSRHIGKDTDVPAGDIGVGGREIGYLFGAYRSYKNSWEGVLTGK GLNWGGSLIRPEATGFGLVYYTQAMIDYATNGKESFEGKRVTISGSGNVAQYAALKVIEL GGIVVSLSDSKGCIISETGITSEQIHDIASAKIRFKSLEEIVDEYSTFSESKMKYVAGAR PWTHVSNVDIALPCATQNEVSGDEAKALVASGVKFVAEGANMGSTPEAISVFETARSTAT NAKDAVWFGPPKAANLGGVAVSGLEMAQNSQKVTWTAERVDQELKKIMINCFNDCIQAAQ EYSTEKNTNTLPSLVKGANIASFVMVADAMLDQGDVF
References
External Links
ResourceLink
Saccharomyces Genome Database GDH3
Uniprot IDP39708
Uniprot NameDHE5_YEAST
GenBank Gene IDU12980
Genebank Protein ID595524
General Reference
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988