Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADP-specific glutamate dehydrogenase 2
Synonyms
  • NADP-GDH 2
  • NADP-dependent glutamate dehydrogenase 2
Gene NameGDH3
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionL-glutamate + H(2)O + NADP(+) = 2-oxoglutarate + NH(3) + NADPH
Cellular LocationNot Available
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
Oxoglutaric acid + Ammonium + NADPH + hydronwater + NADP + L-Glutamic acid
Ammonia + NADPH + hydron + Oxoglutaric acidwater + NADP + L-Glutamic acid
KEGG Reactions
Oxoglutaric acid + NADPH + hydron + AmmoniumNADP + L-Glutamic acid + water
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00423AmmoniumShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
binding
oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
oxidoreductase activity, acting on the CH-NH2 group of donors
Process
oxidation reduction
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 1
LocusYAL062W
Gene Sequence>1374 bp ATGACAAGCGAACCAGAGTTTCAGCAGGCTTACGATGAGATCGTTTCTTCTGTGGAGGAT TCCAAAATTTTTGAAAAATTCCCACAGTATAAAAAAGTGTTACCTATTGTTTCTGTCCCG GAGAGGATCATTCAATTCAGGGTCACGTGGGAAAATGATAATGGCGAGCAAGAAGTGGCT CAAGGATACAGGGTGCAGTTCAATTCAGCCAAGGGCCCTTACAAGGGTGGCCTACGCTTC CACCCATCAGTGAACCTGTCTATCCTAAAATTTTTGGGTTTTGAACAGATCTTCAAGAAT GCGCTCACTGGGCTAGATATGGGCGGTGGTAAGGGTGGCCTGTGTGTGGACTTGAAAGGC AAGTCTGACAACGAGATCAGAAGGATTTGTTATGCGTTCATGAGAGAACTGAGCAGGCAT ATTGGTAAGGACACAGACGTGCCCGCAGGAGATATTGGTGTCGGTGGCCGTGAAATTGGC TACCTATTCGGCGCTTACAGATCATACAAGAACTCCTGGGAAGGTGTGTTGACTGGTAAG GGTTTAAACTGGGGTGGCTCACTTATCAGGCCGGAGGCCACCGGGTTCGGCTTAGTTTAC TATACGCAAGCAATGATCGATTATGCAACAAACGGCAAGGAGTCGTTTGAGGGCAAACGT GTGACAATCTCCGGAAGTGGCAATGTTGCGCAATATGCAGCTTTGAAAGTGATCGAGCTG GGTGGTATTGTGGTGTCTTTATCCGATTCGAAGGGGTGCATCATCTCTGAGACGGGCATT ACTTCTGAGCAAATTCACGATATCGCTTCCGCCAAGATCCGTTTCAAGTCGTTAGAGGAA ATCGTTGATGAATACTCTACTTTCAGCGAAAGTAAGATGAAGTACGTTGCAGGAGCACGC CCATGGACGCATGTGAGCAACGTCGACATTGCCTTGCCCTGTGCCACCCAAAACGAGGTC AGTGGTGACGAAGCCAAGGCCCTAGTGGCATCTGGCGTTAAGTTCGTTGCCGAAGGTGCT AACATGGGTTCTACACCCGAGGCTATTTCTGTTTTCGAAACAGCGCGTAGCACTGCAACC AATGCAAAGGATGCAGTTTGGTTTGGGCCACCAAAGGCAGCTAACCTGGGCGGCGTGGCA GTATCCGGTCTGGAAATGGCTCAGAATTCTCAAAAAGTAACTTGGACTGCCGAGCGGGTC GATCAAGAACTAAAGAAGATAATGATCAACTGCTTCAACGACTGCATACAGGCCGCACAA GAGTACTCTACGGAAAAAAATACAAACACCTTGCCATCATTGGTCAAGGGGGCCAACATT GCCAGCTTCGTCATGGTGGCTGACGCAATGCTTGACCAGGGAGACGTTTTTTAG
Protein Properties
Pfam Domain Function
Protein Residues457
Protein Molecular Weight49626.80078
Protein Theoretical pI5.12
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADP-specific glutamate dehydrogenase 2 MTSEPEFQQAYDEIVSSVEDSKIFEKFPQYKKVLPIVSVPERIIQFRVTWENDNGEQEVA QGYRVQFNSAKGPYKGGLRFHPSVNLSILKFLGFEQIFKNALTGLDMGGGKGGLCVDLKG KSDNEIRRICYAFMRELSRHIGKDTDVPAGDIGVGGREIGYLFGAYRSYKNSWEGVLTGK GLNWGGSLIRPEATGFGLVYYTQAMIDYATNGKESFEGKRVTISGSGNVAQYAALKVIEL GGIVVSLSDSKGCIISETGITSEQIHDIASAKIRFKSLEEIVDEYSTFSESKMKYVAGAR PWTHVSNVDIALPCATQNEVSGDEAKALVASGVKFVAEGANMGSTPEAISVFETARSTAT NAKDAVWFGPPKAANLGGVAVSGLEMAQNSQKVTWTAERVDQELKKIMINCFNDCIQAAQ EYSTEKNTNTLPSLVKGANIASFVMVADAMLDQGDVF
References
External Links
ResourceLink
Saccharomyces Genome Database GDH3
Uniprot IDP39708
Uniprot NameDHE5_YEAST
GenBank Gene IDU12980
Genebank Protein ID595524
General Reference
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988