You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNicotinate phosphoribosyltransferase
Synonyms
  • NAPRTase
Gene NameNPT1
Enzyme Class
Biological Properties
General FunctionInvolved in nicotinate phosphoribosyltransferase activity
Specific FunctionEssential for growth under anaerobic conditions
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB Reactions
water + Adenosine triphosphate + Phosphoribosyl pyrophosphate + Nicotinic acidNicotinic acid mononucleotide + Pyrophosphate + ADP + phosphate
KEGG Reactions
Nicotinic acid + hydron + Phosphoribosyl pyrophosphatePyrophosphate + Nicotinic acid mononucleotide
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00193Nicotinic acid mononucleotideShow
YMDB00219PyrophosphateShow
YMDB00224Nicotinic acidShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00741nicotinic acid D-ribonucleotideShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
nicotinate phosphoribosyltransferase activity
transferase activity, transferring pentosyl groups
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Process
metabolic process
nicotinamide nucleotide biosynthetic process
NAD biosynthetic process
nitrogen compound metabolic process
nucleotide biosynthetic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nicotinate nucleotide biosynthetic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
pyridine nucleotide biosynthetic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR209C
Gene Sequence>1290 bp ATGTCAGAACCAGTGATAAAGTCTCTTTTGGACACAGACATGTACAAGATTACGATGCAT GCTGCTGTCTTCACTAATTTTCCAGATGTTACAGTTACTTATAAATATACCAACAGGTCG TCCCAATTGACCTTCAATAAGGAAGCCATTAATTGGTTGAAAGAGCAATTTTCGTATTTG GGAAATTTGAGGTTCACAGAAGAGGAAATTGAATACTTAAAACAGGAAATCCCATATTTG CCATCGGCATATATTAAGTATATTAGCAGTTCTAATTACAAACTACACCCTGAAGAGCAG ATTTCCTTCACTTCAGAAGAAATCGAGGGCAAGCCCACCCACTACAAATTGAAAATTTTA GTCAGTGGTAGTTGGAAGGATACTATCCTTTATGAGATCCCCTTACTGTCCCTAATATCA GAAGCGTATTTTAAATTTGTTGACATCGACTGGGACTACGAAAACCAATTAGAACAAGCT GAGAAGAAGGCGGAAACTTTGTTTGATAATGGTATTAGATTCAGTGAATTTGGTACAAGA CGTCGTAGATCTCTGAAGGCTCAAGATCTAATTATGCAAGGAATCATGAAAGCTGTGAAC GGTAACCCAGACAGAAACAAATCGCTATTATTAGGCACATCAAATATTTTATTTGCCAAG AAATATGGAGTCAAGCCAATCGGTACTGTGGCTCACGAGTGGGTTATGGGAGTCGCTTCT ATTAGTGAAGATTATTTGCATGCCAATAAAAATGCAATGGATTGTTGGATCAATACTTTT GGTGCAAAAAATGCTGGTTTAGCATTAACGGATACTTTTGGAACTGATGACTTTTTAAAA TCATTCCGTCCACCATATTCTGATGCTTACGTCGGTGTTAGACAAGATTCTGGAGACCCA GTTGAGTATACCAAAAAGATTTCCCACCATTACCATGACGTGTTGAAATTGCCTAAATTC TCGAAGATTATCTGTTATTCCGATTCTTTGAACGTCGAAAAGGCAATAACTTACTCCCAT GCAGCTAAAGAGAATGGAATGCTAGCCACATTCGGTATTGGCACAAACTTTACTAATGAT TTTCGTAAGAAGTCAGAACCCCAGGTTAAAAGTGAGCCGTTAAACATCGTTATCAAACTA TTAGAAGTAAATGGTAATCACGCTATCAAAATTTCTGATAACTTAGGTAAAAATATGGGA GATCCTGCCACTGTGAAGAGAGTGAAAGAGGAATTGGGATATACTGAACGAAGTTGGAGT GGTGATAACGAAGCGCACAGATGGACCTAA
Protein Properties
Pfam Domain Function
Protein Residues429
Protein Molecular Weight49018.19922
Protein Theoretical pI6.92
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Nicotinate phosphoribosyltransferase MSEPVIKSLLDTDMYKITMHAAVFTNFPDVTVTYKYTNRSSQLTFNKEAINWLKEQFSYL GNLRFTEEEIEYLKQEIPYLPSAYIKYISSSNYKLHPEEQISFTSEEIEGKPTHYKLKIL VSGSWKDTILYEIPLLSLISEAYFKFVDIDWDYENQLEQAEKKAETLFDNGIRFSEFGTR RRRSLKAQDLIMQGIMKAVNGNPDRNKSLLLGTSNILFAKKYGVKPIGTVAHEWVMGVAS ISEDYLHANKNAMDCWINTFGAKNAGLALTDTFGTDDFLKSFRPPYSDAYVGVRQDSGDP VEYTKKISHHYHDVLKLPKFSKIICYSDSLNVEKAITYSHAAKENGMLATFGIGTNFTND FRKKSEPQVKSEPLNIVIKLLEVNGNHAIKISDNLGKNMGDPATVKRVKEELGYTERSWS GDNEAHRWT
References
External Links
ResourceLink
Saccharomyces Genome Database NPT1
Uniprot IDP39683
Uniprot NameNPT1_YEAST
GenBank Gene IDZ75117
Genebank Protein ID1420489
PDB ID
1VLP
General Reference
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Lalo, D., Carles, C., Sentenac, A., Thuriaux, P. (1993). "Interactions between three common subunits of yeast RNA polymerases I and III." Proc Natl Acad Sci U S A 90:5524-5528.8516295
  • Panozzo, C., Nawara, M., Suski, C., Kucharczyka, R., Skoneczny, M., Becam, A. M., Rytka, J., Herbert, C. J. (2002). "Aerobic and anaerobic NAD+ metabolism in Saccharomyces cerevisiae." FEBS Lett 517:97-102.12062417
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106