Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative prolyl-tRNA synthetase YHR020W
Synonyms
  • Proline--tRNA ligase
  • ProRS
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-proline + tRNA(Pro) = AMP + diphosphate + L-prolyl-tRNA(Pro)
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Proline + Adenosine triphosphate + tRNA(Pro) → Adenosine monophosphate + Pyrophosphate + Pro-tRNA(Pro) + hydron
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00378L-ProlineShow
YMDB00862hydronShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
proline-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
Process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
prolyl-tRNA aminoacylation
metabolic process
cellular macromolecule metabolic process
macromolecule metabolic process
RNA metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYHR020W
Gene Sequence>2067 bp ATGCCTGTTTCGGAAGCGTTTGCCAAGTTGTGTGTGAATGAGAAGCCTCCTGCTGAATCT GCCGTTGCGGTGAAGTCTTTGGTCTTCAAACCAAAGACTCCAAAGTCCGCCACCCCTGTT CCTATCGTTGTGGTGGCTTTGCAATCTACTACTACTCCTTCTGCGTTGATTGCCAACGCT ACGTCCAGTAAGGATCCAAGATTGGCTCGCGATGATTTGGTCAAGCAAGCGTTCCAATCT GAATCCGCTAGAGCTTTTATCTTGGGGGATTTGGCTAACGCCACGTCCAATTTTCACTTG CTAATTGATCACGAGTTGGGTACTGTTGACGGTGACACTATCTTGCAGTTAAACGACAGT ACTTATATGAAGAAATCTGACATGATGAAATTTCTAAACAATTTTGAGGATAGTCAAAAA GTGGTTGATTTCTCCCAAGAGGTGTCTAAGGAAACCGCTACAGAAGGCAAGAAACAACAG AAAAAGCAGCAACCTTCTAAGGCAGGCACTGCAGCAGCAGCAGCAGCAGCAGCTTTGGAA GACGCCAAACTTATTGGTATCACCGTAGACAAAGCGTTGGATTTCCCAGGCTGGTACCAA CAAATCTTGACCAAGGGTGAAATGTTGGACTACTACGATGTTTCTGGCTGTTACATCTTA AGACCTCCTTCTTATGCGATCTGGGAAAACATTCAGAAATGGTTCGACGACAAGATCAAG GCCATTGGTGTACAAAATGCCTATTTCCCAATGTTTGTTTCCTCACGTGTGTTGGAAAAG GAAAAGGACCATGTTGAAGGCTTTGCTCCAGAAGTTGCCTGGGTCACCAGAGCTGGCTCC TCTGAATTGGAAGAACCAATCGCCATTAGACCAACTTCTGAAACTGTCATGTATCCTTAC TACGCAAAATGGGTCCAGTCTTACAGAGATTTACCATTGAAACTAAACCAATGGAATTCT GTGGTTAGATGGGAATTCAAGCATCCTCAGCCCTTTTTAAGAACCAGAGAATTCTTGTGG CAAGAAGGTCATACTGCTCACTTGACTGCTAAGGATGCCGAAGAGGAGGTTTTGCAAATC TTAGATTTCTACGCTGGGGTTTACGAAGAGTTATTAGCTGTTCCAGTGGTTAAGGGTAGA AAGACCGAAAAGGAAAAATTTGCTGGTGGTGACTTCACCACAACTTGTGAAGGCTATATT CCACAAACCGGTCGTGGTATTCAAGGTGCCACCTCTCACCATTTGGGCCAAAACTTTTCT AAGATGTTCAATTTGTCTGTGGAGAACCCACTAGGTTCTGATCATCCAAAGATCTTTGCG TACCAAAATTCATGGGGTTTATCCACTCGTGTCATTGGTGTCATGGTCATGATCCACTCT GACAACAAGGGTTTGGTTATCCCACCAAGAGTGTCCCAATTCCAATCCGTTGTCATTCCA GTGGGCATCACAAAGAAGACCTCTGAGGAACAGCGTAAACACATTCATGAAACAGCCAGA AGTGTGGAATCCCGTTTGAAAAAGGTTGGCATTAGAGCCTTTGGTGACTATAACGATAAT TACACACCAGGTTGGAAATTTTCCCAATACGAGCTAAAGGGTATTCCAATCCGTATTGAA TTAGGTCCTAAGGATATTGAAAAAAACCAAGTCGTTGTCGTTCGTAGAAATGACTCCAAG AAATACGTCGTTTCTTTCGACGAATTGGAAGCCCGTATCCCAGAAATCTTAGAAGAAATG CAAGGAGATTTGTTCAAAAAAGCCAAGGAGCTATTCGACACCCACAGAGTTATCGTTAAT GAATGGAGTGGTTTTGTTCCAGCATTGAACAAGAAGAACGTTATCTTAGCACCATGGTGT GGTGTGATGGAATGTGAAGAAGATATCAAGGAATCTTCTGCAAAGAAAGACGATGGTGAA GAATTCGAGGAAGATGACAAGGCACCAAGTATGGGTGCCAAATCTTTATGTATCCCATTC GACCAACCTGTATTGAATGAAGGTCAAAAATGTATCAAGTGTGAACGTATTGCTGTCAAT TACTGTATGTTCGGTCGTTCTTATTAG
Protein Properties
Pfam Domain Function
Protein Residues688
Protein Molecular Weight77385.70313
Protein Theoretical pI6.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative prolyl-tRNA synthetase YHR020W MPVSEAFAKLCVNEKPPAESAVAVKSLVFKPKTPKSATPVPIVVVALQSTTTPSALIANA TSSKDPRLARDDLVKQAFQSESARAFILGDLANATSNFHLLIDHELGTVDGDTILQLNDS TYMKKSDMMKFLNNFEDSQKVVDFSQEVSKETATEGKKQQKKQQPSKAGTAAAAAAAALE DAKLIGITVDKALDFPGWYQQILTKGEMLDYYDVSGCYILRPPSYAIWENIQKWFDDKIK AIGVQNAYFPMFVSSRVLEKEKDHVEGFAPEVAWVTRAGSSELEEPIAIRPTSETVMYPY YAKWVQSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHLTAKDAEEEVLQI LDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQGATSHHLGQNFS KMFNLSVENPLGSDHPKIFAYQNSWGLSTRVIGVMVMIHSDNKGLVIPPRVSQFQSVVIP VGITKKTSEEQRKHIHETARSVESRLKKVGIRAFGDYNDNYTPGWKFSQYELKGIPIRIE LGPKDIEKNQVVVVRRNDSKKYVVSFDELEARIPEILEEMQGDLFKKAKELFDTHRVIVN EWSGFVPALNKKNVILAPWCGVMECEEDIKESSAKKDDGEEFEEDDKAPSMGAKSLCIPF DQPVLNEGQKCIKCERIAVNYCMFGRSY
References
External Links
ResourceLink
Saccharomyces Genome Database YHR020W
Uniprot IDP38708
Uniprot NameYHI0_YEAST
GenBank Gene IDU10399
Genebank Protein ID500692
General Reference
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956