Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSphingosine N-acyltransferase LAG1
Synonyms
  • Longevity assurance factor 1
  • Longevity assurance gene 1 protein
  • Longevity assurance protein 1
Gene NameLAG1
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionComponent of the ceramide synthase complex required for C26-CoA-dependent ceramide synthesis. Redundant with LAC1. Facilitates ER-to-Golgi transport of GPI-anchored proteins. Involved in the aging process. Deletion of LAG1 results in a pronounced increase (approximately 50%) in mean and in maximum life span
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
Sphingolipid metabolismPW002479 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sphingolipid metabolismec00600 Map00600
SMPDB Reactions
Succinyl-CoA + SphinganineDihydroceramide + Coenzyme A
KEGG Reactions
Sphinganine + Tetracosanoyl-CoA N-tetracosanoylsphinganine + hydron + Coenzyme A
Sphinganine + hexacosanoyl-CoAN-hexacosanylsphinganine + hydron + Coenzyme A
Phytosphingosine + Tetracosanoyl-CoA N-Tetracosanoylphytosphingosine + hydron + Coenzyme A
Phytosphingosine + hexacosanoyl-CoAN-Hexacosanoylphytosphingosine + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00190SphingosineShow
YMDB00285PhytosphingosineShow
YMDB00327SphinganineShow
YMDB00514Succinyl-CoAShow
YMDB00537hexacosanoyl-CoAShow
YMDB00619N-tetracosanoylsphinganineShow
YMDB00621N-hexacosanylsphinganineShow
YMDB00862hydronShow
YMDB00909Tetracosanoyl-CoA Show
YMDB00963N-TetracosanoylphytosphingosineShow
YMDB00964N-HexacosanoylphytosphingosineShow
YMDB16188DihydroceramideShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
Not Available
Process
Not Available
Gene Properties
Chromosome Locationchromosome 8
LocusYHL003C
Gene Sequence>1236 bp ATGACATCAGCTACGGACAAATCTATCGATAGGTTAGTTGTTAATGCAAAAACAAGAAGA CGAAACTCTTCCGTGGGTAAAATTGATTTAGGTGATACAGTTCCTGGCTTTGCAGCCATG CCTGAAAGTGCTGCCTCTAAAAATGAGGCCAAAAAAAGGATGAAAGCCTTGACTGGTGAC TCTAAAAAGGATAGTGACCTACTGTGGAAGGTTTGGTTTTCATATAGAGAAATGAATTAC CGTCATAGTTGGTTGACACCATTCTTCATACTTGTATGCGTGTATAGCGCGTACTTTTTA TCTGGGAATAGAACAGAATCAAACCCGCTGCACATGTTCGTAGCCATATCATATCAAGTT GATGGCACAGACTCATATGCAAAAGGTATCAAAGATTTGAGTTTTGTGTTTTTCTACATG ATTTTCTTCACATTTTTACGTGAGTTTTTGATGGATGTTGTAATTCGACCATTCACGGTA TACCTAAATGTTACTTCCGAGCATCGTCAAAAGCGTATGCTAGAACAAATGTATGCCATA TTTTATTGCGGAGTTTCAGGGCCCTTTGGTCTTTATATTATGTACCATAGTGATTTGTGG TTGTTCAAGACAAAACCAATGTACAGAACATATCCTGTTATAACCAATCCGTTCTTGTTT AAGATATTTTACTTGGGTCAAGCGGCATTTTGGGCGCAACAGGCTTGTGTTCTTGTTCTA CAATTAGAAAAGCCAAGAAAGGATTACAAGGAATTGGTTTTTCATCACATTGTGACATTA TTATTAATTTGGTCATCATATGTTTTCCATTTTACCAAAATGGGATTGGCTATCTATATT ACTATGGATGTGTCAGATTTTTTCCTTTCTTTGTCTAAGACATTAAACTATCTGAATTCT GTATTTACTCCCTTTGTGTTCGGCTTGTTCGTGTTCTTTTGGATCTATCTGCGCCATGTC GTGAATATCAGAATATTATGGTCAGTCTTAACAGAATTCCGTCATGAAGGTAATTATGTG TTGAATTTTGCCACACAACAATACAAATGTTGGATTTCGTTGCCAATTGTATTTGTACTA ATTGCTGCGTTACAATTAGTTAACCTGTATTGGCTGTTTTTAATTCTTAGAATCTTGTAC AGATTGATATGGCAAGGTATCCAAAAGGACGAAAGAAGTGACAGTGATTCTGATGAGAGC GCTGAAAATGAAGAATCTAAGGAAAAGTGTGAATAA
Protein Properties
Pfam Domain Function
Protein Residues411
Protein Molecular Weight48454.10156
Protein Theoretical pI9.17
Signalling Regions
  • None
Transmembrane Regions
  • 82-102
  • 135-155
  • 177-197
  • 212-232
  • 252-272
  • 297-317
  • 356-376
Protein Sequence>Sphingosine N-acyltransferase LAG1 MTSATDKSIDRLVVNAKTRRRNSSVGKIDLGDTVPGFAAMPESAASKNEAKKRMKALTGD SKKDSDLLWKVWFSYREMNYRHSWLTPFFILVCVYSAYFLSGNRTESNPLHMFVAISYQV DGTDSYAKGIKDLSFVFFYMIFFTFLREFLMDVVIRPFTVYLNVTSEHRQKRMLEQMYAI FYCGVSGPFGLYIMYHSDLWLFKTKPMYRTYPVITNPFLFKIFYLGQAAFWAQQACVLVL QLEKPRKDYKELVFHHIVTLLLIWSSYVFHFTKMGLAIYITMDVSDFFLSLSKTLNYLNS VFTPFVFGLFVFFWIYLRHVVNIRILWSVLTEFRHEGNYVLNFATQQYKCWISLPIVFVL IAALQLVNLYWLFLILRILYRLIWQGIQKDERSDSDSDESAENEESKEKCE
References
External Links
ResourceLink
Saccharomyces Genome Database LAG1
Uniprot IDP38703
Uniprot NameLAG1_YEAST
GenBank Gene IDAY558514
Genebank Protein ID45270918
General Reference
  • D'mello, N. P., Childress, A. M., Franklin, D. S., Kale, S. P., Pinswasdi, C., Jazwinski, S. M. (1994). "Cloning and characterization of LAG1, a longevity-assurance gene in yeast." J Biol Chem 269:15451-15459.8195187
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Barz, W. P., Walter, P. (1999). "Two endoplasmic reticulum (ER) membrane proteins that facilitate ER-to-Golgi transport of glycosylphosphatidylinositol-anchored proteins." Mol Biol Cell 10:1043-1059.10198056
  • Guillas, I., Kirchman, P. A., Chuard, R., Pfefferli, M., Jiang, J. C., Jazwinski, S. M., Conzelmann, A. (2001). "C26-CoA-dependent ceramide synthesis of Saccharomyces cerevisiae is operated by Lag1p and Lac1p." EMBO J 20:2655-2665.11387200
  • Schorling, S., Vallee, B., Barz, W. P., Riezman, H., Oesterhelt, D. (2001). "Lag1p and Lac1p are essential for the Acyl-CoA-dependent ceramide synthase reaction in Saccharomyces cerevisae." Mol Biol Cell 12:3417-3427.11694577
  • Winter, E., Ponting, C. P. (2002). "TRAM, LAG1 and CLN8: members of a novel family of lipid-sensing domains?" Trends Biochem Sci 27:381-383.12151215
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Kolaczkowski, M., Kolaczkowska, A., Gaigg, B., Schneiter, R., Moye-Rowley, W. S. (2004). "Differential regulation of ceramide synthase components LAC1 and LAG1 in Saccharomyces cerevisiae." Eukaryot Cell 3:880-892.15302821
  • Jiang, J. C., Kirchman, P. A., Allen, M., Jazwinski, S. M. (2004). "Suppressor analysis points to the subtle role of the LAG1 ceramide synthase gene in determining yeast longevity." Exp Gerontol 39:999-1009.15236759
  • Vallee, B., Riezman, H. (2005). "Lip1p: a novel subunit of acyl-CoA ceramide synthase." EMBO J 24:730-741.15692566
  • Kageyama-Yahara, N., Riezman, H. (2006). "Transmembrane topology of ceramide synthase in yeast." Biochem J 398:585-593.16756512
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956