You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
Synonyms
  • Glu-ADT subunit B
  • Cytochrome oxidase assembly factor PET112
Gene NamePET112
Enzyme Class
Biological Properties
General FunctionInvolved in carbon-nitrogen ligase activity, with glutamine as amido-N-donor
Specific FunctionFurnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu- tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho- Glu-tRNA(Gln)
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00109Adenosine triphosphateShow
YMDB00271L-Glutamic acidShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
ligase activity
ligase activity, forming carbon-nitrogen bonds
carbon-nitrogen ligase activity, with glutamine as amido-N-donor
Process
metabolic process
biosynthetic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
Gene Properties
Chromosome Locationchromosome 2
LocusYBL080C
Gene Sequence>1626 bp ATGTTGCGGCTTGCACGTTTTTATTCTTTGGCCAGAACCAAAGCCATACATAGTCACGGT GCACCCTTCAGGCCGGAATATGCATTGAAGTGTGGATTGGAGATTCATACGCAATTGAAC ACCAAAAACAAGCTTTTTTCACAATCAACGAATAGCGCCACATCTCTAGTGGATGCACCA AACCATCATACTAGTTATTATGACATAGCTCTACCGGGAACGCAGCCGGTTTTGAATCTG GAAGCAATCTTGTTTGCCATGAAACTATCCTTGGCACTGGGTTCTCAAGTGAATAGCATA TCTCAGTTTGATAGGAAGCATTATTTTTATGGAGATCAACCTCAAGGCTATCAACTGACG CAGCACTACAGGCCGTTTGCTCGGGGTGGGAAGATCAATCTGTCGAAGGAATTGGATGAT ATCGATGAATCAGCCAAGGAAATCGGTATCTTACAGTTGCAGATAGAGCAGGACACGGGG AAGTCACACTATACAGAGACAGATAAAGACGTTATTACTTTGGTTGATTTAAATAGGTCG AACGTCCCGCTTATCGAATTGGTAACTAAACCAGATTTCAGTGATATTAAACAGGTTAGA GCGTTTATTAAAAAATATCAGAATTTGGTACGTCATTTGCACATTTCCTCTGGGGACCTG GAAACGGGCGCCATGCGAGTGGACGTTAACCTCTCAATTAATGAATATGCACGCGTTGAG TTGAAGAATTTACCCAATACTAGTTCCATCATCAATGCAATCAAGTACGAATATCAGCGG CAAGTTGAGTTGATTTCTGTGGGTGACACTAGCTCACTGATGGAGCCAGAAACAAGGGGC TGGACAGGCTCATCAACGGTGAAGTTGAGAAGCAAAGAAACCACGATCGATTACAGGTAC ATGCCTGATCCAGAATTGCCGTATATCAACCTCGCACCAGACGTTATCAGTGGTGTGAGA GGGTTGATGCCCCAATTACCGGACGATATAATGAGAATTCTTATGAAGAAACCCTATCAA TTATCATTGAAGGACGCCAAGATTCTGACTTATAATAGTAACCAAAACGATATGTACAAT CATGAGGCGTTGAGATCGTACTACTTAGACACCTTCCGTGAATTTTCCAAGCTTGCTGGT GAACGTAGTAACGCGAAATTACCTACGAATTGGATAATCCATGAATTCTTGGGAGATTTG AACAAGCTACAAATTCCATTGGCCAAAGCAAAAGAAATTTTGCCTCCTCCGGTTTTCGCC CAGTTTTTGAAGTTATTGCATGAAGAGGTTATATCCGCAACTAGTGGTAAAATGTTACTG TTTCACATATTGGAAAATTTCGAGCAGAGTAACTGCCAAGATTTGTCTATTCCAGATTTT TCAAAACTAATCGAGAAATTTGAATTGCATGCGATTAATCAGGTCGACCCTCAAGAATTG ATGGATCTCTGTAATGATGTCATTGCACAGCACACAGATGACACTTTTATACGGAACCTG GTTACTGGTAAAAAGAAGTCCTCTTTAAAATTCCTAATTGGACAAGGAATGAGACGAAGC CAGGGACGTATAAAGGCAAACGAATTCGAGAAAAAATTCAAAGAGATCTTAAATATTCAA TGGTAA
Protein Properties
Pfam Domain Function
Protein Residues541
Protein Molecular Weight61842.19922
Protein Theoretical pI7.8
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial MLRLARFYSLARTKAIHSHGAPFRPEYALKCGLEIHTQLNTKNKLFSQSTNSATSLVDAP NHHTSYYDIALPGTQPVLNLEAILFAMKLSLALGSQVNSISQFDRKHYFYGDQPQGYQLT QHYRPFARGGKINLSKELDDIDESAKEIGILQLQIEQDTGKSHYTETDKDVITLVDLNRS NVPLIELVTKPDFSDIKQVRAFIKKYQNLVRHLHISSGDLETGAMRVDVNLSINEYARVE LKNLPNTSSIINAIKYEYQRQVELISVGDTSSLMEPETRGWTGSSTVKLRSKETTIDYRY MPDPELPYINLAPDVISGVRGLMPQLPDDIMRILMKKPYQLSLKDAKILTYNSNQNDMYN HEALRSYYLDTFREFSKLAGERSNAKLPTNWIIHEFLGDLNKLQIPLAKAKEILAPPVFA QFLKLLHEEVISATSGKMLLFHILENFEQSNCQDLSIPDFSKLIEKFELHAINQVDPQEL MDLCNDVIAQHTDDTFIRNLVTGKKKSSLKFLIGQGMRRSQGRIKANEFEKKFKEILNIQ W
References
External Links
ResourceLink
Saccharomyces Genome Database PET112
Uniprot IDP33893
Uniprot NameGATB_YEAST
GenBank Gene IDL22072
Genebank Protein ID347493
General Reference
  • Mulero, J. J., Rosenthal, J. K., Fox, T. D. (1994). "PET112, a Saccharomyces cerevisiae nuclear gene required to maintain rho+ mitochondrial DNA." Curr Genet 25:299-304.8082172
  • Obermaier, B., Gassenhuber, J., Piravandi, E., Domdey, H. (1995). "Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II." Yeast 11:1103-1112.7502586
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Frechin, M., Senger, B., Braye, M., Kern, D., Martin, R. P., Becker, H. D. (2009). "Yeast mitochondrial Gln-tRNA(Gln) is generated by a GatFAB-mediated transamidation pathway involving Arc1p-controlled subcellular sorting of cytosolic GluRS." Genes Dev 23:1119-1130.19417106