You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameImidazole glycerol phosphate synthase hisHF
Synonyms
  • IGP synthase
  • IGPS
  • ImGP synthase
  • Glutamine amidotransferase
  • Cyclase
Gene NameHIS7
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionIGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The glutamine amidotransferase domain provides the ammonia necessary to the cyclase domain to produce IGP and AICAR from PRFAR
Cellular LocationNot Available
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
Phosphoribulosylformimino-AICAR-P + L-GlutamineL-Glutamic acid + hydron + 5-Amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide + D-Erythro-imidazole-glycerol-phosphate
KEGG Reactions
5-[(5-phospho-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide + L-Glutamine5-Amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide + L-Glutamic acid + hydron + D-Erythro-imidazole-glycerol-phosphate
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00089D-Erythro-imidazole-glycerol-phosphateShow
YMDB000925-[(5-phospho-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-phospho-D-ribosyl)imidazole-4-carboxamideShow
YMDB00271L-Glutamic acidShow
YMDB005625-Amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamideShow
YMDB00862hydronShow
YMDB16239Phosphoribulosylformimino-AICAR-PShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring pentosyl groups
imidazoleglycerol-phosphate synthase activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
histidine family amino acid metabolic process
histidine metabolic process
histidine biosynthetic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR248C
Gene Sequence>1659 bp ATGCCGGTCGTTCACGTGATTGACGTTGAAAGTGGTAACCTACAGTCACTAACCAATGCA ATTGAGCATTTAGGTTACGAAGTACAACTGGTGAAATCACCAAAGGATTTTAACATATCA GGCACGTCAAGATTGATTTTGCCTGGTGTCGGAAATTATGCCCATTTCGTCGACAATTTA TTTAATAGAGGATTCGAAAAGCCGATAAGAGAATACATTGAATCTGGAAAACCAATAATG GGAATTTGCGTCGGGCTACAAGCGCTCTTTGCCGGTTCCGTGGAAAGCCCTAAGAGTACG GGTCTGAACTACATTGATTTTAAGTTGTCCAGGTTCGATGATTCAGAAAAGCCAGTACCA GAAATAGGTTGGAATTCTTGCATTCCCTCGGAAAACCTATTCTTTGGATTGGATCCATAC AAGAGGTACTATTTCGTCCATTCTTTTGCTGCCATTCTGAATTCAGAAAAGAAAAAAAAC CTAGAAAATGACGGTTGGAAAATTGCAAAAGCTAAGTACGGTTCAGAGGAATTTATTGCG GCAGTCAACAAGAATAATATATTCGCTACTCAGTTCCATCCTGAAAAATCAGGTAAAGCT GGTTTGAACGTCATTGAGAATTTTTTGAAGCAACAAAGTCCTCCGATTCCAAACTATAGT GCGGAAGAGAAGGAACTCTTAATGAATGACTATTCAAATTATGGTCTAACACGCAGAATT ATTGCTTGTCTTGATGTACGTACTAATGACCAAGGTGATTTGGTGGTTACTAAAGGTGAT CAATACGATGTACGTGAAAAAAGTGATGGTAAAGGTGTTAGAAACCTTGGTAAGCCTGTT CAGTTGGCACAGAAATATTACCAACAGGGTGCGGATGAAGTAACATTTTTGAATATAACT TCTTTTAGAGATTGTCCTTTGAAGGATACTCCGATGCTAGAGGTTCTGAAACAAGCCGCA AAGACAGTCTTTGTTCCATTGACAGTCGGTGGGGGGATCAAGGATATTGTCGATGTTGAT GGAACCAAAATACCTGCTTTAGAAGTTGCAAGTCTATACTTCAGATCTGGTGCTGATAAA GTATCGATCGGTACGGATGCAGTCTATGCAGCCGAAAAATACTACGAGTTGGGTAACAGA GGAGATGGAACGTCACCAATAGAGACAATCTCGAAAGCATACGGTGCTCAGGCAGTTGTT ATTTCTGTCGACCCTAAGAGAGTATATGTAAATTCACAAGCAGATACGAAGAACAAAGTC TTCGAGACAGAATATCCGGGCCCCAATGGAGAGAAATACTGCTGGTACCAATGTACAATC AAAGGTGGAAGAGAATCTAGAGACCTTGGTGTGTGGGAATTAACAAGGGCATGTGAAGCT CTAGGTGCTGGGGAGATTTTATTGAACTGCATAGACAAGGATGGCTCTAATTCTGGTTAT GATCTGGAATTGATAGAACATGTTAAAGATGCGGTCAAGATTCCCGTCATTGCATCCAGT GGCGCCGGTGTACCCGAACATTTCGAAGAGGCCTTCCTAAAGACCCGCGCAGATGCTTGC TTGGGTGCAGGTATGTTCCACAGAGGTGAATTCACTGTTAACGATGTAAAGGAGTATTTA CTAGAGCACGGATTAAAGGTTAGAATGGATGAAGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues552
Protein Molecular Weight61067.60156
Protein Theoretical pI5.15
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Imidazole glycerol phosphate synthase hisHF MPVVHVIDVESGNLQSLTNAIEHLGYEVQLVKSPKDFNISGTSRLILPGVGNYGHFVDNL FNRGFEKPIREYIESGKPIMGICVGLQALFAGSVESPKSTGLNYIDFKLSRFDDSEKPVP EIGWNSCIPSENLFFGLDPYKRYYFVHSFAAILNSEKKKNLENDGWKIAKAKYGSEEFIA AVNKNNIFATQFHPEKSGKAGLNVIENFLKQQSPPIPNYSAEEKELLMNDYSNYGLTRRI IACLDVRTNDQGDLVVTKGDQYDVREKSDGKGVRNLGKPVQLAQKYYQQGADEVTFLNIT SFRDCPLKDTPMLEVLKQAAKTVFVPLTVGGGIKDIVDVDGTKIPALEVASLYFRSGADK VSIGTDAVYAAEKYYELGNRGDGTSPIETISKAYGAQAVVISVDPKRVYVNSQADTKNKV FETEYPGPNGEKYCWYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSGY DLELIEHVKDAVKIPVIASSGAGVPEHFEEAFLKTRADACLGAGMFHRGEFTVNDVKEYL LEHGLKVRMDEE
References
External Links
ResourceLink
Saccharomyces Genome Database HIS7
Uniprot IDP33734
Uniprot NameHIS5_YEAST
GenBank Gene IDX69815
Genebank Protein ID395155
PDB ID
1OX6
General Reference
  • Kuenzler, M., Balmelli, T., Egli, C. M., Paravicini, G., Braus, G. H. (1993). "Cloning, primary structure, and regulation of the HIS7 gene encoding a bifunctional glutamine amidotransferase: cyclase from Saccharomyces cerevisiae." J Bacteriol 175:5548-5558.8366040
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Chaudhuri, B. N., Lange, S. C., Myers, R. S., Chittur, S. V., Davisson, V. J., Smith, J. L. (2001). "Crystal structure of imidazole glycerol phosphate synthase: a tunnel through a (beta/alpha)8 barrel joins two active sites." Structure 9:987-997.11591353